Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

3 accessions found for Pelobacter propionicus DSM 2379  

Data for CP000482  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000482.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000482_3433 CDS_3845599-3844130 59.5 2.7e-17 1
CP000482_3114 CDS_3471347-3472492 57.2 1.3e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000482_3433 1/1 288 355 .. 1 70 [] 59.5 2.7e-17
CP000482_3114 1/1 182 249 .. 1 70 [] 57.2 1.3e-16

Alignments of top-scoring domains:
CP000482_3433: domain 1 of 1, from 288 to 355: score 59.5, E = 2.7e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +AR++HD++gQsL+++kl le+++++l ++ +++e++ e+
CP000482_3 288 ERLAMARDIHDEIGQSLTVLKLDLEWIAHRL--PAKESAVQERVNEM 332

relarealaevRrllgdLRpaal<-*
r +++ + v r++ dLRp+ l
CP000482_3 333 RWNIEQLTSAVQRIAADLRPPLL 355

CP000482_3114: domain 1 of 1, from 182 to 249: score 57.2, E = 1.3e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR AR++HD++gQ+L aiklql +++ ++ + +al ei
CP000482_3 182 ERARVARDIHDGIGQTLQAIKLQLKIRQARC--REGEPCGGQALNEI 226

relarealaevRrllgdLRpaal<-*
+ + a +e+R+++ +LRp l
CP000482_3 227 IGELTSAATELREIILALRPLFL 249


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 4 0|=
-13 55 0|=====
-12 101 39|===*=====
-11 172 327|=============== *
-10 469 760|======================================== *
-9 685 863|==========================================================*
-8 540 665|============================================= *
-7 450 418|==================================*===
-6 346 236|===================*=========
-5 320 127|==========*================
-4 149 66|=====*=======
-3 114 34|==*=======
-2 69 17|=*====
-1 36 8|*==
0 18 4|*=
1 25 2|*==
2 11 1|*
3 5 0|=
4 2 0|=
> 5 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1211.4741
P(chi-square) = 0

Total sequences searched: 3576

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: