Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Paracoccus denitrificans PD1222  

Data for CP000489  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000489.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000489_2786 CDS_2837624-2835831 82.0 2.6e-23 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000489_2786 1/1 380 466 .. 1 94 [] 82.0 2.6e-23

Alignments of top-scoring domains:
CP000489_2786: domain 1 of 1, from 380 to 466: score 82.0, E = 2.6e-23
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+I+S++++Q r ++ ++ + +Lr q+RV+S
CP000489_2 380 EVHHRVKNNLQLIASIINMQIRVIDHDDA-----RRVLRSVQDRVAS 421

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
A+i++ LY+ e ld+v+ + ++ +++++ ++ + + g++++ +
CP000489_2 422 LATIYRNLYQAEHLDSVEADRLIRDIINQMTNASVGPGAGLRID--T 466


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-15 2 0|=
-14 6 0|=
-13 38 17|=*=
-12 199 183|=============*=
-11 820 511|====================================*======================
-10 630 662|============================================= *
-9 409 559|============================== *
-8 323 375|======================== *
-7 143 222|=========== *
-6 134 124|========*=
-5 34 66|=== *
-4 27 35|==*
-3 12 18|=*
-2 8 9|*
-1 8 5|*
> 0 6 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 311.9163
P(chi-square) = 0

Total sequences searched: 2799

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: