Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Bradyrhizobium sp. BTAi1  

Data for CP000494  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000494.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000494_3970 CDS_4432432-4433520 105.2 1.8e-29 1
CP000494_1535 CDS_1705341-1704046 76.6 2.4e-21 1
CP000494_6313 CDS_7008029-7006935 76.1 3.3e-21 1
CP000494_1707 CDS_1871980-1873005 62.0 3.3e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000494_3970 1/1 160 243 .. 1 94 [] 105.2 1.8e-29
CP000494_1535 1/1 208 292 .. 1 94 [] 76.6 2.4e-21
CP000494_6313 1/1 150 236 .. 1 94 [] 76.1 3.3e-21
CP000494_1707 1/1 146 221 .. 1 80 [. 62.0 3.3e-17

Alignments of top-scoring domains:
CP000494_3970: domain 1 of 1, from 160 to 243: score 105.2, E = 1.8e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+LQ+I+SLL LQa +++ e+v ++aL + +RV++
CP000494_3 160 EVNHRVGNSLQIIASLLHLQANSSSQEDV-----KAALTNAMGRVAA 201

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++LY+s dl++v + +Yl+ L+++L++s+++ + l
CP000494_3 202 VAQVHRRLYTSHDLKSVLLNQYLDALLDDLRRSAEGNRMSR-----L 243

CP000494_1535: domain 1 of 1, from 208 to 292: score 76.6, E = 2.4e-21
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L+ + ++Lr Qa + + e+ + aL E+ +RV++
CP000494_1 208 EMSHRVKNSLASVVAMLRVQAFGAGSVEA-----KQALGEAGSRVAA 249

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L++ ++++d++ +l+ ++ L +g ++ L++D
CP000494_1 250 IAQVHDHLSRASRIGSIDVDVFLTDFCKRLQLVAGA---HV-LRCDA 292

CP000494_6313: domain 1 of 1, from 150 to 236: score 76.1, E = 3.3e-21
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRV N+L++I+S+++L ar++++ee+ + +L ++++RV+S
CP000494_6 150 EFQHRVGNSLAIIASIISLKARSVSSEEA-----RRHLDDARDRVIS 191

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
A i++ L+ s + v +++ + +L+ + qs+ + ++i+++ +
CP000494_6 192 FANIQQSLHASARSGVVALGPHFARLCQAIAQSMIADHQRIRIE--T 236

CP000494_1707: domain 1 of 1, from 146 to 221: score 62.0, E = 3.3e-17
*->EIHHRVKNNLQvISSLLrLQarkf...kdeevikdEVleaLrEsqnR
E +HRV NN Q I++LL++Q r++ + +++ + +L E+q R
CP000494_1 146 ELQHRVANNIQFIAGLLMMQKRQAiadPSRA------IGILDEAQAR 186

VlSmAliHEeLYksedldtvdfseYlekLtenLfqs<-*
++++ iH++L+ + +vd+++Yl++++++ ++s
CP000494_1 187 LQTISRIHRMLHDP-GRMDVDIGPYLQEICNDVLDS 221


Histogram of all scores:
score obs exp (one = represents 34 sequences)
----- --- ---
-15 14 0|=
-14 52 0|==
-13 123 46|=*==
-12 493 485|==============*
-11 1996 1352|=======================================*===================
-10 1667 1749|================================================== *
-9 1171 1478|=================================== *
-8 842 991|========================= *
-7 428 588|============= *
-6 326 328|=========*
-5 120 176|==== *
-4 80 93|==*
-3 32 49|=*
-2 18 25|*
-1 11 13|*
0 2 6|*
1 0 3|*
2 4 1|*
3 0 0|
4 1 0|=
5 1 0|=
6 0 0|
7 1 0|=
8 0 0|
9 1 0|=
10 1 0|=
11 0 0|
12 1 0|=
13 3 0|=
> 14 6 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 596.6563
P(chi-square) = 0

Total sequences searched: 7394

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: