Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Bradyrhizobium sp. BTAi1  

Data for CP000494  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000494.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000494_2893 CDS_3224535-3222184 69.4 6.7e-20 1
CP000494_5022 CDS_5575192-5576550 59.5 5.5e-17 1
CP000494_5696 CDS_6297999-6299564 59.0 7.9e-17 1
CP000494_5575 CDS_6156571-6155225 52.1 8.1e-15 1
CP000494_4361 CDS_4863658-4864389 50.7 2.2e-14 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000494_2893 1/1 583 649 .. 1 70 [] 69.4 6.7e-20
CP000494_5022 1/1 252 320 .. 1 70 [] 59.5 5.5e-17
CP000494_5696 1/1 303 370 .. 1 70 [] 59.0 7.9e-17
CP000494_5575 1/1 240 310 .. 1 70 [] 52.1 8.1e-15
CP000494_4361 1/1 31 99 .. 1 70 [] 50.7 2.2e-14

Alignments of top-scoring domains:
CP000494_2893: domain 1 of 1, from 583 to 649: score 69.4, E = 6.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD++gQsL+++ l+l+++ + + + p ++++++d i
CP000494_2 583 ERQRIARELHDTLGQSLTMLQLGLQAIGHEI--AGGP-KLQQRFDGI 626

relarealaevRrllgdLRpaal<-*
+++a+ ++v r+++++Rp+a
CP000494_2 627 KTIADSLGRDVHRIATEIRPSAI 649

CP000494_5022: domain 1 of 1, from 252 to 320: score 59.5, E = 5.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD+ gQ+L+ai +++++ + ++ +++ ++ +++i
CP000494_5 252 ERRALARELHDEFGQNLTAILAFASTIESAG--KDRNDQMAQDARMI 296

relarealaevRrllgdLR.paal<-*
+ + + +a +R +l++LR+p a+
CP000494_5 297 TQSVTHLMACLRGTLSRLRrPLAE 320

CP000494_5696: domain 1 of 1, from 303 to 370: score 59.0, E = 7.9e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+++ARELHD+ gQsL+ai+ + + r + + + ++a + d i
CP000494_5 303 ERRHLARELHDEFGQSLAAIRALAAAMRESV--ALACPAALGECDSI 347

relarealaevRrllgdLRpaal<-*
+++a + ++ +R +l +LRp++
CP000494_5 348 ARTAADMMETLRGALVRLRPPDI 370

CP000494_5575: domain 1 of 1, from 240 to 310: score 52.1, E = 8.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ER+ IARELHD+ g +L+a++ +++++ rl +s++ d ++ r++ ++
CP000494_5 240 ERKEIARELHDEFGPHLFALRAHASALMRLPESgTLDVAAMRRHGQA 286

irelarealaevRrllgdLRpaal<-*
i + ++ ++ Rr+l +LRp +l
CP000494_5 287 ILDQVNAVQQFNRRILERLRPVGL 310

CP000494_4361: domain 1 of 1, from 31 to 99: score 50.7, E = 2.2e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+R+ RELHD++ QsL++i+ + ++ r l +++ ++ ++ + e
CP000494_4 31 ERRRLGRELHDGLCQSLAGIAALTAALSRDL--AANVGpGPAASASE 75

irelarealaevRrllgdLRpaal<-*
i +l++ea++e+R+l+++L p a
CP000494_4 76 ILRLLNEAISEARDLARGLTPVAV 99


Histogram of all scores:
score obs exp (one = represents 22 sequences)
----- --- ---
-15 2 0|=
-14 24 0|==
-13 89 1|*====
-12 168 82|===*====
-11 331 677|================ *
-10 913 1572|========================================== *
-9 1263 1785|==========================================================*
-8 1136 1376|==================================================== *
-7 1005 865|=======================================*======
-6 799 489|======================*==============
-5 690 262|===========*====================
-4 358 137|======*==========
-3 242 70|===*=======
-2 127 36|=*====
-1 95 18|*====
0 46 9|*==
1 28 4|*=
2 27 2|*=
3 20 1|*
4 15 0|=
5 2 0|=
6 3 0|=
7 4 0|=
> 8 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3117.7354
P(chi-square) = 0

Total sequences searched: 7394

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: