Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Bradyrhizobium sp. BTAi1  

Data for CP000494  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000494.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000494_6155 CDS_6837984-6836515 140.5 1.9e-47 1
CP000494_1305 CDS_1469153-1467468 132.9 7.4e-45 1
CP000494_2639 CDS_2909788-2908271 126.5 1.2e-42 1
CP000494_6584 CDS_7340472-7338814 125.6 2.3e-42 1
CP000494_2055 CDS_2253303-2252068 113.8 2.3e-38 1
CP000494_2197 CDS_2411826-2414354 109.8 5.5e-37 1
CP000494_4059 CDS_4524080-4525579 99.6 1.6e-33 1
CP000494_5171 CDS_5735008-5732897 95.2 5.3e-32 1
CP000494_4710 CDS_5240993-5241994 93.7 1.7e-31 1
CP000494_4017 CDS_4480664-4482742 88.9 7.5e-30 1
CP000494_0641 CDS_693901-692519 84.5 2.4e-28 1
CP000494_7218 CDS_8076961-8077923 81.8 1.9e-27 1
CP000494_1657 CDS_1828603-1827509 76.4 1.4e-25 1
CP000494_5877 CDS_6505946-6502338 68.7 5.7e-23 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000494_6155 1/1 289 370 .. 1 85 [] 140.5 1.9e-47
CP000494_1305 1/1 368 448 .. 1 85 [] 132.9 7.4e-45
CP000494_2639 1/1 314 394 .. 1 85 [] 126.5 1.2e-42
CP000494_6584 1/1 347 425 .. 1 85 [] 125.6 2.3e-42
CP000494_2055 1/1 86 168 .. 1 85 [] 113.8 2.3e-38
CP000494_2197 1/1 520 602 .. 1 85 [] 109.8 5.5e-37
CP000494_4059 1/1 294 372 .. 1 85 [] 99.6 1.6e-33
CP000494_5171 1/1 514 592 .. 1 85 [] 95.2 5.3e-32
CP000494_4710 1/1 142 228 .. 1 85 [] 93.7 1.7e-31
CP000494_4017 1/1 499 581 .. 1 85 [] 88.9 7.5e-30
CP000494_0641 1/1 268 348 .. 1 85 [] 84.5 2.4e-28
CP000494_7218 1/1 142 218 .. 1 85 [] 81.8 1.9e-27
CP000494_1657 1/1 183 262 .. 1 85 [] 76.4 1.4e-25
CP000494_5877 1/1 999 1081 .. 1 85 [] 68.7 5.7e-23

Alignments of top-scoring domains:
CP000494_6155: domain 1 of 1, from 289 to 370: score 140.5, E = 1.9e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA+VQS+a QTlR+a+sl++f+ aFsgR+qA s aHd+
CP000494_6 289 ELNHRVKNILAIVQSVAGQTLRTAPSLPAFNKAFSGRIQAVSIAHDI 335

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+++W g + eLl+ LaPyg +++Ri+++GP+
CP000494_6 336 --LTQTRWIGIGFNELLTTVLAPYGV-GEGRIVIEGPP 370

CP000494_1305: domain 1 of 1, from 368 to 448: score 132.9, E = 7.4e-45
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E nHRVKNtL +VQSiar ++ +a ++d++v+aF+gR+ ALs+a +L
CP000494_1 368 EINHRVKNTLGTVQSIARLSRSSASDVDHYVAAFEGRILALSEAYNL 414

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+ +W gAd r+++e++LaPy+g ++R+t+sGP+
CP000494_1 415 --LTENNWVGADVRAIVERTLAPYAG--PDRLTISGPS 448

CP000494_2639: domain 1 of 1, from 314 to 394: score 126.5, E = 1.2e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+ Q+ia QT+R+a + e+F+gRL AL++aH+L
CP000494_2 314 ELNHRVKNTLAILQAIAVQTFRSASRFER--EKFEGRLGALAEAHNL 358

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ + W+g +L +++ + L Py+ + +eRi+++GP
CP000494_2 359 --LSKEKWQGSELEDVIGRVLKPYRLNTPERIRITGPK 394

CP000494_6584: domain 1 of 1, from 347 to 425: score 125.6, E = 2.3e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LAv+QSi++ TlR+ ++d ++e ++gR++A+s++ L
CP000494_6 347 ELNHRVKNILAVIQSIVTRTLRHGSDIDVARELLIGRIHAMSNVVTL 393

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++s+W+g+ Lr L e+ P+ a+Ri ++GPd
CP000494_6 394 --LSESQWQGVQLRGLFESRAIPH----ADRIAVTGPD 425

CP000494_2055: domain 1 of 1, from 86 to 168: score 113.8, E = 2.3e-38
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KNtLA+V +i+ Q+l + + +++ a+sgRLqAL+raHdL
CP000494_2 86 ELQHRIKNTLATVGAIVSQSLSGLPAAKDAQHAISGRLQALGRAHDL 132

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +++W++AdL+ +++ +++++++d R+ + GP+
CP000494_2 133 --LLQARWSSADLGTVIRNSIQAFDDPDVSRFSILGPE 168

CP000494_2197: domain 1 of 1, from 520 to 602: score 109.8, E = 5.5e-37
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRV+N+L++V ++++Q+ +a+s++ef++ + gR+qAL+raHd+
CP000494_2 520 ELNHRVRNILSLVRGLVAQSKDTANSVEEFAAILGGRIQALARAHDQ 566

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t +Wa++ Lr Lle+e ++y g+ a+R++++GPd
CP000494_2 567 --ITNLNWAPVALRHLLESEAGAYLGARAGRVRMEGPD 602

CP000494_4059: domain 1 of 1, from 294 to 372: score 99.6, E = 1.6e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR KN L++ QSi+r T a+s+ +v a++gR+ AL+r+H +
CP000494_4 294 EVDHRAKNALTLAQSIVRLT--KADSVRTYVSAVEGRISALARVHTI 338

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ s+W+gA+++ L+ +eLaPy++ ++++ + G +
CP000494_4 339 --LSLSSWQGAEISRLIGEELAPYAT--GGQVAFGGAE 372

CP000494_5171: domain 1 of 1, from 514 to 592: score 95.2, E = 5.3e-32
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HRVKN+LAvVQS+a+Q l d v+ F+ RL+AL+ +H
CP000494_5 514 ELAHRVKNSLAVVQSLAHQLLP---RQDVKVRNFISRLHALATVHTS 557

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W+gAdL++L+++++aP+++ +++++++GP+
CP000494_5 558 --LAENDWQGADLAALIQSQVAPFAST-PDQLVIHGPT 592

CP000494_4710: domain 1 of 1, from 142 to 228: score 93.7, E = 1.7e-31
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HRVKN+L++ ++ ++T+R+aa++++++ +++ RL AL+ra+dL
CP000494_4 142 EMSHRVKNLLTIATALTQMTSRTAATKEDMAHDLASRLIALGRAQDL 188

V.p.LtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
++ + r++ a A L++L++ LaPy+ ++++ Ri++s P
CP000494_4 189 IhSrPGRTS-AAALLGDLVSVLLAPYDEKgASVRIRVSVPK 228

CP000494_4017: domain 1 of 1, from 499 to 581: score 88.9, E = 7.5e-30
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+NtLAv+ Si+r T +++s+++f+ ++gR+ ALsr+++
CP000494_4 499 ELQHRVRNTLAVIRSIIRRTGDSSDSIEDFASHLEGRITALSRVQSA 545

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+tr+ ag dL++L++ eL++ ++ +e++ l GP+
CP000494_4 546 --ITRDPFAGFDLAQLIADELRAGAAREDEQFSLAGPP 581

CP000494_0641: domain 1 of 1, from 268 to 348: score 84.5, E = 2.4e-28
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+nHR+KN+L++VQ+iarQ R+ + ld e+F +RLqA ++ +dL
CP000494_0 268 EVNHRSKNLLSLVQAIARQMTRRGRPLDL--ERFLQRLQAIASNQDL 312

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W+ L+ L++++L+++ + + Ri ++GP+
CP000494_0 313 --LIQNDWRFIPLGGLVRSQLGAFSDLVGNRIAIDGPE 348

CP000494_7218: domain 1 of 1, from 142 to 218: score 81.8, E = 1.9e-27
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KN ++++++ +Q l+ + ++ + +++ R++AL++a dL
CP000494_7 142 ELHHRLKNKTSTIHAVLHQVLH---DQPQVWSSIDKRIRALAGADDL 185

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ r +++g+dL++Ll +eL+Pyg + R++l G++
CP000494_7 186 --IARVDAQGCDLKDLLMSELGPYG---HVRFELNGDP 218

CP000494_1657: domain 1 of 1, from 183 to 262: score 76.4, E = 1.4e-25
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+V S+++ + R + l ef e ++gR++AL r+H L
CP000494_1 183 ELNHRVKNTLALVDSVIALSIRADTALTEFGEVLRGRIAALTRSHAL 229

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++ + L eL++aeLaP +R+ ++GP+
CP000494_1 230 --ALDRGREALGLDELVQAELAPLQ---CDRVAVEGPA 262

CP000494_5877: domain 1 of 1, from 999 to 1081: score 68.7, E = 5.7e-23
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+L vV S a T+R +++l +f+ +F++RL ALsr+++L
CP000494_5 999 ELQHRTRNLLGVVRSTADKTARASTDLSDFRVRFRDRLEALSRVQGL 1045

V.pLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++L +++ + + +L++ eL++ +g ++eRi+l+GP+
CP000494_5 1046 LsRLGEHD--RVAFDDLIRTELSAVAG-GSERIVLDGPA 1081


Histogram of all scores:
score obs exp (one = represents 24 sequences)
----- --- ---
-17 2 0|=
-16 0 0|
-15 4 0|=
-14 18 0|=
-13 108 0|=====
-12 543 0|=======================
-11 702 60|==*===========================
-10 1093 764|===============================*==============
-9 1379 1892|==========================================================*
-8 1262 1964|===================================================== *
-7 912 1319|====================================== *
-6 508 720|====================== *
-5 364 356|==============*=
-4 201 169|=======*=
-3 125 78|===*==
-2 76 36|=*==
-1 34 16|*=
0 21 7|*
1 8 3|*
2 9 1|*
3 3 0|=
4 2 0|=
5 1 0|=
6 1 0|=
> 7 18 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 7652.0190
P(chi-square) = 0

Total sequences searched: 7394

Whole sequence top hits:
tophits_s report:
Total hits: 14
Satisfying E cutoff: 14
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 14
Satisfying E cutoff: 14
Total memory: 26K


Acknowledgements:

This research is funded by:

Developed by: