Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Mycobacterium vanbaalenii PYR-1  

Data for CP000511  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000511.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000511_1625 CDS_1750434-1749508 77.9 1.7e-22 1
CP000511_1340 CDS_1442549-1441338 69.0 6.9e-20 1
CP000511_4310 CDS_4705868-4707205 69.0 7e-20 1
CP000511_5438 CDS_5905072-5903912 63.0 4.2e-18 1
CP000511_5393 CDS_5858357-5857014 57.7 1.5e-16 1
CP000511_1378 CDS_1486501-1488180 51.0 1.4e-14 1
CP000511_1396 CDS_1503128-1504834 49.3 4.5e-14 1
CP000511_5820 CDS_6294170-6292944 33.0 2.8e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000511_1625 1/1 116 180 .. 1 70 [] 77.9 1.7e-22
CP000511_1340 1/1 196 265 .. 1 70 [] 69.0 6.9e-20
CP000511_4310 1/1 244 311 .. 1 70 [] 69.0 7e-20
CP000511_5438 1/1 176 245 .. 1 70 [] 63.0 4.2e-18
CP000511_5393 1/1 231 301 .. 1 70 [] 57.7 1.5e-16
CP000511_1378 1/1 369 434 .. 1 70 [] 51.0 1.4e-14
CP000511_1396 1/1 374 440 .. 1 70 [] 49.3 4.5e-14
CP000511_5820 1/1 219 284 .. 1 70 [] 33.0 2.8e-09

Alignments of top-scoring domains:
CP000511_1625: domain 1 of 1, from 116 to 180: score 77.9, E = 1.7e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD++gQsL+++ l l +a d++p+ + +l+
CP000511_1 116 ERQRIARELHDEIGQSLTVALLTLKRAI-----DRAPAGPQPELEYT 157

relarealaevRrllgdLRpaal<-*
++++r +l evR+++++LRp+al
CP000511_1 158 QQTIRACLGEVRDIARRLRPDAL 180

CP000511_1340: domain 1 of 1, from 196 to 265: score 69.0, E = 6.9e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A ++HD+++Q+L ++ l++a+++++s+ dp+++ e+ld++
CP000511_1 196 ERRRLAGDIHDGISQRLVTLSYRLDAAAQAATSPGDPDALHEQLDRA 242

relarealaevRrllgdLRpaal<-*
rela+ +l+e+R+++++LRp++l
CP000511_1 243 RELAELTLQEARAAISGLRPPVL 265

CP000511_4310: domain 1 of 1, from 244 to 311: score 69.0, E = 7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHDsv +L ++++ ++la++ l d+d ++a++ ++e+
CP000511_4 244 ERHRIERDLHDSVQPRLVSLAMTIGLAQTKL--DSDLPAAKALIAEA 288

relarealaevRrllgdLRpaal<-*
++ a+ al e+R++++++ p++l
CP000511_4 289 HDDAKNALVELRNVVRGIAPTIL 311

CP000511_5438: domain 1 of 1, from 176 to 245: score 63.0, E = 4.2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ER+RIARE HD++++sL++ l++ +arr l ++d+d +ea eal++
CP000511_5 176 ERRRIAREVHDVIAHSLTVTLLHVTGARRGL-QeDRDVDEAVEALEQ 221

irelarealaevRrllgdLRpaal<-*
+++l+r+a+a++Rr++g L +a+
CP000511_5 222 AERLGRQAMADIRRTVGLLDDAVG 245

CP000511_5393: domain 1 of 1, from 231 to 301: score 57.7, E = 1.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+RIARELHDsv+Q+ ++ +q+e++r +d ++ +e+ ++ld
CP000511_5 231 ERHRIARELHDSVAQTVLSAGMQIEVCRSEID-ASGRNrELVDRLDL 276

irelarealaevRrllgdLR.paal<-*
+++l r a +++R ++ +L +p++
CP000511_5 277 AKHLTRSATEQLRSAIYALNqPGDA 301

CP000511_1378: domain 1 of 1, from 369 to 434: score 51.0, E = 1.4e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
R RIAR+LHD v Q+L+a+ l l++ +++ ++e+re+l+
CP000511_1 369 DRDRIARDLHDHVIQRLFAVGLALQGTI-----PRARApEVRERLTD 410

irelarealaevRrllgdLRpaal<-*
+ + +++ ++e+R ++ dL+ +
CP000511_1 411 CVDDLQQVIQEIRTAIFDLHGGHG 434

CP000511_1396: domain 1 of 1, from 374 to 440: score 49.3, E = 4.5e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+RIA +LHD v Q+ +a+ + l+++ +++ +++ ++ e+l +
CP000511_1 374 DRERIAHDLHDQVIQRVFAVGMDLQGVVARV--RSP--ALNERLSNS 416

relarealaevRrllgdLR.paal<-*
+ ++ ++e+R ++ +L++pa+
CP000511_1 417 VDELQAVITEIRSTIFNLQkPAEA 440

CP000511_5820: domain 1 of 1, from 219 to 284: score 33.0, E = 2.8e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI +LHD v ++L a++l l+la+ + ++ a + ++ +
CP000511_5 219 ERRRIESDLHDRVQHRLMALALTLGLAENVH--GDN--DAGRLAADA 261

relarealaevRrllgdLRpaal<-*
++ +++ ae+R++l +++p al
CP000511_5 262 HRQVDDIAAELRAVLLGIQPRAL 284


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 5 0|=
-13 31 0|==
-12 117 66|===*===
-11 191 547|============ *
-10 596 1271|==================================== *
-9 963 1443|========================================================= *
-8 929 1112|======================================================= *
-7 898 699|=========================================*===========
-6 708 395|=======================*==================
-5 661 212|============*==========================
-4 337 110|======*=============
-3 190 57|===*========
-2 145 29|=*=======
-1 71 14|*====
0 51 7|*==
1 24 3|*=
2 19 1|*=
3 15 0|=
4 8 0|=
5 3 0|=
6 2 0|=
7 0 0|
8 2 0|=
9 2 0|=
10 0 0|
11 0 0|
> 12 11 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3764.9651
P(chi-square) = 0

Total sequences searched: 5979

Whole sequence top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: