Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

1 accessions found for Acidovorax citrulli AAC00-1  

Data for CP000512  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CP000512.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000512_2027 CDS_2259155-2264023 94.2 2.7e-26 1
CP000512_2586 CDS_2885256-2886620 92.2 1e-25 1
CP000512_4201 CDS_4744501-4747356 91.6 1.5e-25 1
CP000512_3920 CDS_4433780-4430301 81.2 1.3e-22 1
CP000512_2196 CDS_2458394-2455875 80.4 2.2e-22 1
CP000512_3039 CDS_3412195-3413982 80.0 2.9e-22 1
CP000512_3462 CDS_3901161-3897568 79.2 4.8e-22 1
CP000512_2923 CDS_3263638-3264534 77.0 2e-21 1
CP000512_1866 CDS_2056547-2059720 71.8 6e-20 1
CP000512_2374 CDS_2641425-2636818 70.5 1.5e-19 1
CP000512_1417 CDS_1590985-1592070 69.4 2.9e-19 1
CP000512_0306 CDS_351039-349588 68.4 5.6e-19 1
CP000512_4554 CDS_5161666-5160209 65.9 2.9e-18 1
CP000512_2924 CDS_3264540-3266531 64.5 7.4e-18 1
CP000512_4283 CDS_4848585-4846708 63.9 1.1e-17 1
CP000512_2950 CDS_3308786-3310462 62.1 3.5e-17 1
CP000512_3888 CDS_4393893-4392466 59.2 2.3e-16 1
CP000512_4445 CDS_5031226-5028908 58.5 3.6e-16 1
CP000512_0847 CDS_942641-940935 58.2 4.4e-16 1
CP000512_2962 CDS_3322734-3324191 56.6 1.2e-15 1
CP000512_3217 CDS_3619700-3620875 56.5 1.3e-15 1
CP000512_3917 CDS_4428842-4427670 56.2 1.6e-15 1
CP000512_0347 CDS_385601-388399 56.0 1.8e-15 1
CP000512_3128 CDS_3513494-3514822 55.6 2.3e-15 1
CP000512_3095 CDS_3476255-3478507 50.4 7e-14 1
CP000512_0041 CDS_48630-50078 49.7 1.1e-13 1
CP000512_2480 CDS_2771300-2770242 49.6 1.2e-13 1
CP000512_0263 CDS_305523-304282 48.1 3.1e-13 1
CP000512_4496 CDS_5096546-5095119 47.7 4e-13 1
CP000512_0167 CDS_194158-192671 47.1 5.9e-13 1
CP000512_1466 CDS_1658680-1657097 45.4 1.8e-12 1
CP000512_4646 CDS_5279107-5276921 45.0 2.4e-12 2
CP000512_0854 CDS_951314-949854 44.0 4.5e-12 1
CP000512_3455 CDS_3889795-3890889 43.8 5.4e-12 1
CP000512_2418 CDS_2686404-2683831 43.5 6.5e-12 1
CP000512_4242 CDS_4799588-4798509 42.8 9.9e-12 1
CP000512_2227 CDS_2499218-2498007 41.4 2.5e-11 1
CP000512_4060 CDS_4588323-4586908 40.1 5.8e-11 1
CP000512_0219 CDS_255957-257894 39.8 7.2e-11 1
CP000512_2925 CDS_3266553-3269222 39.4 9.4e-11 1
CP000512_3476 CDS_3915927-3914440 38.7 1.5e-10 1
CP000512_1554 CDS_1750075-1748558 35.5 1.2e-09 1
CP000512_3497 CDS_3935879-3937513 30.5 3e-08 1
CP000512_2929 CDS_3272576-3273205 30.2 3.6e-08 1
CP000512_4571 CDS_5185604-5183481 27.2 2.7e-07 1
CP000512_3961 CDS_4490330-4489608 27.1 2.9e-07 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000512_2027 1/1 872 937 .. 1 87 [] 94.2 2.7e-26
CP000512_2586 1/1 205 271 .. 1 87 [] 92.2 1e-25
CP000512_4201 1/1 418 483 .. 1 87 [] 91.6 1.5e-25
CP000512_3920 1/1 473 541 .. 1 87 [] 81.2 1.3e-22
CP000512_2196 1/1 608 673 .. 1 87 [] 80.4 2.2e-22
CP000512_3039 1/1 365 430 .. 1 87 [] 80.0 2.9e-22
CP000512_3462 1/1 742 808 .. 1 87 [] 79.2 4.8e-22
CP000512_2923 1/1 61 129 .. 1 87 [] 77.0 2e-21
CP000512_1866 1/1 700 766 .. 1 87 [] 71.8 6e-20
CP000512_2374 1/1 1166 1232 .. 1 87 [] 70.5 1.5e-19
CP000512_1417 1/1 137 202 .. 1 87 [] 69.4 2.9e-19
CP000512_0306 1/1 269 334 .. 1 87 [] 68.4 5.6e-19
CP000512_4554 1/1 246 312 .. 1 87 [] 65.9 2.9e-18
CP000512_2924 1/1 283 348 .. 1 87 [] 64.5 7.4e-18
CP000512_4283 1/1 241 306 .. 1 87 [] 63.9 1.1e-17
CP000512_2950 1/1 306 373 .. 1 87 [] 62.1 3.5e-17
CP000512_3888 1/1 228 293 .. 1 87 [] 59.2 2.3e-16
CP000512_4445 1/1 536 608 .. 1 87 [] 58.5 3.6e-16
CP000512_0847 1/1 329 394 .. 1 87 [] 58.2 4.4e-16
CP000512_2962 1/1 252 315 .. 1 87 [] 56.6 1.2e-15
CP000512_3217 1/1 163 228 .. 1 87 [] 56.5 1.3e-15
CP000512_3917 1/1 162 227 .. 1 87 [] 56.2 1.6e-15
CP000512_0347 1/1 682 746 .. 1 87 [] 56.0 1.8e-15
CP000512_3128 1/1 207 278 .. 1 87 [] 55.6 2.3e-15
CP000512_3095 1/1 361 427 .. 1 87 [] 50.4 7e-14
CP000512_0041 1/1 247 312 .. 1 87 [] 49.7 1.1e-13
CP000512_2480 1/1 134 198 .. 1 87 [] 49.6 1.2e-13
CP000512_0263 1/1 198 260 .. 1 87 [] 48.1 3.1e-13
CP000512_4496 1/1 241 306 .. 1 87 [] 47.7 4e-13
CP000512_0167 1/1 281 345 .. 1 87 [] 47.1 5.9e-13
CP000512_1466 1/1 285 347 .. 1 87 [] 45.4 1.8e-12
CP000512_4646 1/2 335 403 .. 1 87 [] 44.5 3.3e-12
CP000512_0854 1/1 263 331 .. 1 87 [] 44.0 4.5e-12
CP000512_3455 1/1 148 211 .. 1 87 [] 43.8 5.4e-12
CP000512_2418 1/1 606 676 .. 1 87 [] 43.5 6.5e-12
CP000512_4242 1/1 139 203 .. 1 87 [] 42.8 9.9e-12
CP000512_2227 1/1 185 249 .. 1 87 [] 41.4 2.5e-11
CP000512_4060 1/1 233 313 .. 1 87 [] 40.1 5.8e-11
CP000512_0219 1/1 422 490 .. 1 87 [] 39.8 7.2e-11
CP000512_2925 1/1 516 584 .. 1 87 [] 39.4 9.4e-11
CP000512_3476 1/1 280 345 .. 1 87 [] 38.7 1.5e-10
CP000512_1554 1/1 256 315 .. 1 87 [] 35.5 1.2e-09
CP000512_3497 1/1 162 232 .. 1 87 [] 30.5 3e-08
CP000512_2929 1/1 1 46 [. 22 87 .] 30.2 3.6e-08
CP000512_4571 1/1 458 537 .. 1 87 [] 27.2 2.7e-07
CP000512_3961 1/1 4 79 .. 1 87 [] 27.1 2.9e-07

Alignments of top-scoring domains:
CP000512_2027: domain 1 of 1, from 872 to 937: score 94.2, E = 2.7e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks flan+sHE+RTP++aI+g+++l+l+ + l++ q
CP000512_2 872 LKSNFLANMSHEIRTPMNAIIGMSHLALK---------SGLTPRQ-- 907

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++y+ +i++++++ll ind+Ld+srieag
CP000512_2 908 ----------ADYVAKIQQAGQHLLGVINDILDFSRIEAG 937

CP000512_2586: domain 1 of 1, from 205 to 271: score 92.2, E = 1e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++f+an+sHE+RTPLt+++g++e+L++ +ls+e+r
CP000512_2 205 MRRDFVANVSHEIRTPLTVLMGFVETLQT---------LPLSSEER- 241

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++yl+ + ++a r+++ ++dlL+lsr+e
CP000512_2 242 ----------ARYLNMMSQQAGRMQSVVQDLLTLSRLEGS 271

CP000512_4201: domain 1 of 1, from 418 to 483: score 91.6, E = 1.5e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k fla +sHE+RTPL+aI+g+a+l+l+ ++l++ q
CP000512_4 418 EKATFLAVMSHEIRTPLNAILGLAQLALR---------EPLPPAQ-- 453

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e +e ++r+++rllr+++d Ld+s+i+ g
CP000512_4 454 ----------QERVEQLYRAGRRLLRIVDDTLDFSKIDGG 483

CP000512_3920: domain 1 of 1, from 473 to 541: score 81.2, E = 1.3e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
kseflan+sHELRTPL++ + +a+lL + + ++l+eeq
CP000512_3 473 YKSEFLANMSHELRTPLNSSLILAKLLAD------NKGGNLTEEQ-- 511

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+y eti+ +++ ll+Lind+Ldl++ieag
CP000512_3 512 ----------VRYAETIHGAGNDLLNLINDILDLAKIEAG 541

CP000512_2196: domain 1 of 1, from 608 to 673: score 80.4, E = 2.2e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+an+sHELRTPL aI+g+ael + ++e
CP000512_2 608 TRTQFVANMSHELRTPLQAIIGFAELGSA---------RSQDERL-- 643

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ il +++r+l+L+ndlLd ++ie+
CP000512_2 644 ----------GAMFTDILAAGQRMLALVNDLLDVAKIESD 673

CP000512_3039: domain 1 of 1, from 365 to 430: score 80.0, E = 2.9e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aksefl ++sHELRTPLt+I g+ael++ l +
CP000512_3 365 AKSEFLTAISHELRTPLTSIHGFAELMEQ----------RLEQPS-- 399

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yre+ i+++ae+l+ L++++Ldl++ +ag
CP000512_3 400 ---------YREAAGLIRSAAEHLNTLLSEILDLAKVQAG 430

CP000512_3462: domain 1 of 1, from 742 to 808: score 79.2, E = 4.8e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+ ++++sHELRTPL++I+gya+l+ e d+ ++
CP000512_3 742 AKSRYISAISHELRTPLNSILGYAQLMGE--------DASVPPHR-- 778

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+++ +i+r +e+ll Li+ Ld++rie+g
CP000512_3 779 ----------RQAVGVIRRGGEHLLTLIEGTLDIARIESG 808

CP000512_2923: domain 1 of 1, from 61 to 129: score 77.0, E = 2e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ks+fla++sHE+RTP+++Ir a lL + +d ++l++eq
CP000512_2 61 MKSRFLAYMSHEFRTPISSIRSIARLLADHVD------GPLNAEQ-- 99

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + i+ a +++++dlLdl++ieag
CP000512_2 100 ----------SRQVAFIQATAMEFSDMVDDLLDLAKIEAG 129

CP000512_1866: domain 1 of 1, from 700 to 766: score 71.8, E = 6e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+efl +lsHELR+PL+aI +++++L + ++ ++e++
CP000512_1 700 AKDEFLTMLSHELRNPLAAIAAASDVLST---------GAGGAETT- 736

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++l +i+r++++l ++ +dlLd sr g
CP000512_1 737 ----------SQALGIIQRQTQHLASMMRDLLDVSRVLRG 766

CP000512_2374: domain 1 of 1, from 1166 to 1232: score 70.5, E = 1.5e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++fla lsHELR+PL++I g++ +L + +++++++
CP000512_2 1166 TKDRFLAVLSHELRNPLASIAGASAVLAT--------EGAAPADR-- 1202

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ ++++r+a+ + L++dl+dlsr++ g
CP000512_2 1203 ----------DQAARIVQRQARAMAVLLDDLMDLSRLRLG 1232

CP000512_1417: domain 1 of 1, from 137 to 202: score 69.4, E = 2.9e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a e+++nl+HE+++PL +Irg+a+lL++ el+ +++
CP000512_1 137 ANKELIRNLAHEIKNPLGGIRGAAQLLEM----------ELDNPEL- 172

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ey+++i++ea+rl++L+++lL r +
CP000512_1 173 ----------AEYTQVIIHEADRLQSLVDRLLAPHRHPHL 202

CP000512_0306: domain 1 of 1, from 269 to 334: score 68.4, E = 5.6e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +++l HEL+ P++aIrg+ elL++ +l+ ++r
CP000512_0 269 YIEGYVRALTHELKSPVAAIRGAGELLQD----------DLPGDDR- 304

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++ + +++erl+rL+++lL+ls++e+
CP000512_0 305 ----------RQFAAQVVDQSERLQRLVDRLLELSKLEQR 334

CP000512_4554: domain 1 of 1, from 246 to 312: score 65.9, E = 2.9e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +fla+++H+L+TPL+++r+ a+l+++ + s e++
CP000512_4 246 TQKRFLADAAHQLKTPLAGLRMQADLAQR---------EGTSTEDL- 282

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l+ i r++ r + +n+lL l+r+eag
CP000512_4 283 ----------KRSLQQIGRASVRATHTVNQLLALARAEAG 312

CP000512_2924: domain 1 of 1, from 283 to 348: score 64.5, E = 7.4e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++f+a lsHELRTPL+aI g +++L++ ++e +
CP000512_2 283 TKDDFIAVLSHELRTPLNAIAGWVHILKR---------RGGTPELIK 320

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l++i+r ++ r+i+d+Ld sri +g
CP000512_2 321 G------------LDSIHRNVKAQARIISDILDVSRINSG 348

CP000512_4283: domain 1 of 1, from 241 to 306: score 63.9, E = 1.1e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k++fl+++sH+LR+PL+a+ +++e ++ ++++
CP000512_4 241 EKNRFLSTASHDLRQPLHAMGLLVESAQQ---------RNADAGL-- 276

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
le i+++a++l L n lLdlsr+e+g
CP000512_4 277 ----------VPVLEGIQDCARSLTFLFNALLDLSRLESG 306

CP000512_2950: domain 1 of 1, from 306 to 373: score 62.1, E = 3.5e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++++a+lsHELRTP taIrg ae++l++ + +++e+
CP000512_2 306 RRRQLFADLSHELRTPATAIRGEAEIALRG--------GVRPAEE-- 342

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yr+ le+i ++e+l ++dl+ +r ea
CP000512_2 343 ---------YRQTLERIVGAVEQLTGTVDDLMLVARTEAD 373

CP000512_3888: domain 1 of 1, from 228 to 293: score 59.2, E = 2.3e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ f+a+++HELR PL+a+++ ++ L++ + see r
CP000512_3 228 AQQHFVADAAHELRSPLAALKLQLQGLQR----------AGSEEAR- 263

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + ++ ++r rL+++lL l+r ea
CP000512_3 264 ----------AVAAGRLAAGIDRATRLVEQLLALARQEAS 293

CP000512_4445: domain 1 of 1, from 536 to 608: score 58.5, E = 3.6e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e ++ l+HE+++PLt I++ ae L+++l +++ +++ e +
CP000512_4 536 AWGEVARRLAHEIKNPLTPIQLSAERLEMKL---TGKLGAAEEAVL- 578

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ ++ti ++++ + rL+n+++d++r+ a
CP000512_4 579 ----------AKSVKTIVDQVDAMKRLVNEFRDYARLPAA 608

CP000512_0847: domain 1 of 1, from 329 to 394: score 58.2, E = 4.4e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++++ a+++HE+R+PL+aI + lL+e +ls++ +
CP000512_0 329 AMGRMSAAVAHEIRNPLAAIVQANALLEE----------DLSDPAH- 364

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++ + +++ a rl r+ +++Ld++r +++
CP000512_0 365 ----------RRLAHMVQQNAARLARIAEEVLDIARVQHQ 394

CP000512_2962: domain 1 of 1, from 252 to 315: score 56.6, E = 1.2e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +f++++sH+LRTPL++++ ++ +l+ ++ +++q+
CP000512_2 252 HQKRFVRDASHQLRTPLAVLKVQVQSALR---------GDVPPQQA- 288

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+ il+ ++r +L n++L l++ e+
CP000512_2 289 -------------LHEILDTVDRATQLANQMLALAKVEQL 315

CP000512_3217: domain 1 of 1, from 163 to 228: score 56.5, E = 1.3e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ef+ n++HELRTPL++Ir+ a +l+ ++ ++
CP000512_3 163 AQREFAGNVAHELRTPLAGIRAQAANALA---------QDDPAVW-- 198

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r l+ i ++ +r +r +n+lL l+r+ +g
CP000512_3 199 ----------RSELQGIADAEQRASRTVNQLLALARAAEG 228

CP000512_3917: domain 1 of 1, from 162 to 227: score 56.2, E = 1.6e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ f+a lsH+LR PL+aI++ a +L++ t +++
CP000512_3 162 LSEMFMAVLSHDLRGPLSAILASAAVLRK---------TQEPDKV-- 197

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++++ +a+r+ r+i+dlLd +r ++
CP000512_3 198 ----------LAMADKVQTSAQRMGRMIEDLLDVTRVRQF 227

CP000512_0347: domain 1 of 1, from 682 to 746: score 56.0, E = 1.8e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ +l ++sH+ RTPLta++++ae L + +++e +
CP000512_0 682 LRNALLGAISHDVRTPLTALIALAESLPA-----------QPDEAL- 716

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + i ++a++l +L+++lLd++r+e+g
CP000512_0 717 ----------PAASQAIVQQAHQLHALVSNLLDMARLESG 746

CP000512_3128: domain 1 of 1, from 207 to 278: score 55.6, E = 2.3e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ +sH+LR+PLt+I+++++lL +++ a+ t+ +++++
CP000512_3 207 FAEQMIGIVSHDLRNPLTTILLATDLLTRQA----ASPTPTPPDTA- 248

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l i r+++r +rLi dlLd++ + g
CP000512_3 249 ----------ARMLGNITRAGQRARRLIADLLDFTVVRLG 278

CP000512_3095: domain 1 of 1, from 361 to 427: score 50.4, E = 7e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ L+aI+g++el+++ + + +
CP000512_3 361 AVGTMAGGIAHDFNNILSAILGNVELAKA---------DCAAGSPV- 397

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e l+ i+++++r ++L++++L++sr e +
CP000512_3 398 ----------LESLREIEKAGRRARDLVRQILTFSRNEPP 427

CP000512_0041: domain 1 of 1, from 247 to 312: score 49.7, E = 1.1e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ef+ n++HELRTPL++Ir++a l+ ++++
CP000512_0 247 AQREFAGNVAHELRTPLAGIRALAAYGLA----------HKDPAV-- 281

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++e l + + r ++L+++lL l+ +++
CP000512_0 282 ---------WHEQLAGVAASEARASHLVDQLLALALADEV 312

CP000512_2480: domain 1 of 1, from 134 to 198: score 49.6, E = 1.2e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ + a+++HELRTP+t + g ++ L e+++ e+
CP000512_2 134 QRAFWNAAIAHELRTPVTILHGRLQGLTEGVF----------EPR-- 168

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+++ +lr ++ l+rLi+dl+ ls ++g
CP000512_2 169 ----------AELFQGLLRHVQGLSRLIEDLRMLSLRDSG 198

CP000512_0263: domain 1 of 1, from 198 to 260: score 48.1, E = 3.1e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +lan+sHELR PLt Ir+ +el++ ++ s+
CP000512_0 198 SHKSLLANASHELRSPLTRIRMGLELMQG---------STPSPAF-- 233

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ilr + l++L++++L sr++a
CP000512_0 234 -------------RSEILRNIAELDQLVDEILLASRLDAR 260

CP000512_4496: domain 1 of 1, from 241 to 306: score 47.7, E = 4e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++ ++HELRTPL++I + a +L + ++ q
CP000512_4 241 RERRLANEVAHELRTPLSSIVLQARALGG---------GLDGPAQ-- 276

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+l +i ++a r + +n+lL l+r+
CP000512_4 277 ----------AEALARIGQDALRAGHVLNQLLALARASRT 306

CP000512_0167: domain 1 of 1, from 281 to 345: score 47.1, E = 5.9e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++a+++HE+R+P++a+r+ a+ +l+ + ++ +
CP000512_0 281 ALGRMTASVAHEIRNPIAAMRLKADNALA----------APPARH-- 315

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l i +++rl+ L++ lL+l + +
CP000512_0 316 ----------ADALAAIGTQIDRLEGLVQSLLTLVQPLQL 345

CP000512_1466: domain 1 of 1, from 285 to 347: score 45.4, E = 1.8e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++++ +++HELRTPL+a+r+ +e+ ++++ + ++ +
CP000512_1 285 SRRQWIGDVAHELRTPLAAMRAEIEAVQDGV-------RTFDDRT-- 322

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++r++ rl +L+ dl + ++a
CP000512_1 323 -------------ALRLHRQVMRLIQLVGDL--RASLDAA 347

CP000512_4646: domain 1 of 2, from 335 to 403: score 44.5, E = 3.3e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +++H++++ L++I++ ++lL+ s ++
CP000512_4 335 AVGQLTGGIAHDFNNLLAGIMASLDLLRL----------RVSQGRVA 371

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ ++ ++t++r+a+r +L +lL +sr ++
CP000512_4 372 DM--------ERCIDTAHRSAKRAASLTHRLLAFSRRQTL 403

CP000512_0854: domain 1 of 1, from 263 to 331: score 44.0, E = 4.5e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k +fl+++sHEL+TPL+++r + lL++++ +el++ q
CP000512_0 263 DKARFLRHISHELKTPLASMREGVALLQDGVT------GELGAGQ-- 301

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re ++++++ + l+ i+ lL + + +
CP000512_0 302 ----------REVVDILHQNTLVLQGEIEALLRFNAAAFE 331

CP000512_3455: domain 1 of 1, from 148 to 211: score 43.8, E = 5.4e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ fl l H+LR PL+a+ +++el+ + + + q+
CP000512_3 148 WREIFLGVLGHDLRGPLNAVALMVELMAK---------QGIAPVQQ- 184

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++r ++r+ L++ lL++sr g
CP000512_3 185 -------------TAMLERGVHRMTTLLDSLLEYSRSNLG 211

CP000512_2418: domain 1 of 1, from 606 to 676: score 43.5, E = 6.5e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e++++++HEL++PLtaI+ y++ + +s + +
CP000512_2 606 TMGEMASSVAHELNQPLTAISNYCSGMVS---------RIKSQQITE 643

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++L +le+ ++a+r ++i++++ + + ++
CP000512_2 644 DAL-------LSALEKTAHQAQRAGQIIQRIRAFVKKSEP 676

CP000512_4242: domain 1 of 1, from 139 to 203: score 42.8, E = 9.9e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ +a++sHELRTPLt++r+ ++++ +++ e+++++
CP000512_4 139 ERRAHAASISHELRTPLTVLRARLHAICDGV-------IEADAQE-- 176

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +l+++e+l rL+ dl +ls +ea
CP000512_4 177 -------------SRALLEQVEYLGRLVGDLHTLSMAEAD 203

CP000512_2227: domain 1 of 1, from 185 to 249: score 41.4, E = 2.5e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++ la+++H+LRTPL ++++ a +++ ++e++++ +
CP000512_2 185 ARERVLAAVAHDLRTPLQVLQLSATHIQR--------SAEAPPDAV- 222

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++l+++ + +L++ lL s +
CP000512_2 223 -------------VQRMLSAVGMMASLVEGLLRPSDSAST 249

CP000512_4060: domain 1 of 1, from 233 to 313: score 40.1, E = 5.8e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+a+++H+LRTPL+++++ +e+ +++ +++
CP000512_4 233 GQRRFVADAAHQLRTPLAGLQAQVEAWAL---------AARAADH-- 268

peLR....l....edpeyreyletilreaerllrLindlLdlsrieag<-
+R +++l +++ + + + +e ++++a+r ++L +lL lsr++ag
CP000512_4 269 --GRagdgLvqggIVLG-VQDIEALRKAARRTSKLAHQLLALSRADAG 313

*

CP000512_4 - -

CP000512_0219: domain 1 of 1, from 422 to 490: score 39.8, E = 7.2e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++++a++sHEL++PL+a++++++ + + + ++ + e+
CP000512_0 422 VLGQMAAGMSHELNQPLAALQTLSDNAVA------LDRQGRREDV-- 460

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e l+ i + a r+ r++++l + r e++
CP000512_0 461 ----------AENLQLIGQLAARMGRIVRQLKSFVRKETP 490

CP000512_2925: domain 1 of 1, from 516 to 584: score 39.4, E = 9.4e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +l+H++++ L++I+g +elL +++ ++ r
CP000512_2 516 AVGQLTGGLAHDFNNLLATISGSLELLNRRV-----------AQGRF 551

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ L ++y+ + + +a+r +L ++L +sr ++
CP000512_2 552 DDL-------ARYVAVGQGAARRAASLTHRMLAFSRRQTL 584

CP000512_3476: domain 1 of 1, from 280 to 345: score 38.7, E = 1.5e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ f+a++ H+LR+PL + +++a lL + + +++
CP000512_3 280 LRQTFAAAVTHDLRNPLQTAMLAANLLAK---------LNDDPKF-- 315

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +l +++r+ +rl+r++ Ld +++g
CP000512_3 316 ----------AGLLARLQRSHKRLDRMLKASLDKIALDSG 345

CP000512_1554: domain 1 of 1, from 256 to 315: score 35.5, E = 1.2e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +la++sH+LRTPL+ +r+ +e+ + ++
CP000512_1 256 DRAVMLAGISHDLRTPLARLRLETEM------------SVIDDVA-- 288

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e + ++ +l++ i+ +Ld++r ++
CP000512_1 289 -------------REHMVADIVQLDATIDKFLDYARPDHV 315

CP000512_3497: domain 1 of 1, from 162 to 232: score 30.5, E = 3e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++ ++sH++++ L +++g++++++ ++++l+ e++
CP000512_3 162 ALGQLTGGISHDFNNLLQVMSGHLDVMRV-----RNRSQKLGREDI- 202

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++i++++ + L ++lL +sr +
CP000512_3 203 ----------DRSIDSIRSAVGKASTLTQQLLAFSRKQKL 232

CP000512_2929: domain 1 of 1, from 1 to 46: score 30.2, E = 3.6e-08
*->gyaelLleeldkvlagdtelseeqrlpeLRledpeyreyletilrea
++a +L++ d+++s + ++ ++i++++
CP000512_2 1 MAARVLEK--------DGDASGRT------------GRLGQRIQSSS 27

erllrLindlLdlsrieag<-*
r++rL+++++d+sr+++g
CP000512_2 28 SRMQRLVSQVMDMSRLQSG 46

CP000512_4571: domain 1 of 1, from 458 to 537: score 27.2, E = 2.7e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+e+++ lsHEL++PL+aI ya+ + l++++e+ + +
CP000512_4 458 TVGEMASLLSHELNQPLAAIASYASGSIN-----LLESAEAAPGGHG 499

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
p+ + p +r l++i ++aer r i + d+ r + +
CP000512_4 500 PAS--FLPDVRVGLQRIAQQAERAGRVIKSVHDFVRRRDQ 537

CP000512_3961: domain 1 of 1, from 4 to 79: score 27.1, E = 2.9e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +efl ++sH+LR PL I + l +e ++ + + l++ r+
CP000512_3 4 AHDEFLHAVSHDLRAPLRHIVSFGPLVRELVE---DEAQGLPAGARA 47

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +l t++++++r+ r+++ lL lsri
CP000512_3 48 EA--------CSFLGTMDQASRRMGRMLDGLLALSRIARA 79


Histogram of all scores:
score obs exp (one = represents 16 sequences)
----- --- ---
-14 8 0|=
-13 35 3|*==
-12 189 107|======*=====
-11 389 558|========================= *
-10 764 1035|================================================ *
-9 896 1069|======================================================== *
-8 818 800|=================================================*==
-7 641 504|===============================*=========
-6 379 290|==================*=====
-5 249 159|=========*======
-4 122 85|=====*==
-3 67 45|==*==
-2 56 23|=*==
-1 15 12|*
0 12 6|*
1 10 3|*
2 4 1|*
3 3 0|=
4 1 0|=
5 0 0|
> 6 51 -|====


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 403.1971
P(chi-square) = 0

Total sequences searched: 4709

Whole sequence top hits:
tophits_s report:
Total hits: 46
Satisfying E cutoff: 46
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 46
Satisfying E cutoff: 46
Total memory: 39K


Acknowledgements:

This research is funded by:

Developed by: