hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000524.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000524_0243 CDS_244912-243884 118.2 1.3e-40 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000524_0243 1/1 148 230 .. 1 85 [] 118.2 1.3e-40
Alignments of top-scoring domains:
CP000524_0243: domain 1 of 1, from 148 to 230: score 118.2, E = 1.3e-40
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN+LA++QSia QT+R ++sl+ f+++F gRL++ s ++dL
CP000524_0 148 EVSHRSKNLLAIIQSIASQTARYTESLQTFLRKFQGRLHSISHSQDL 194
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t s+W+gA +reL++++ y ++ e++ ++G +
CP000524_0 195 --ITASDWRGAKFRELVRSQTLDYSTKEVEQLSIEGSN 230
Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-15 2 0|=
-14 40 0|==========
-13 63 0|================
-12 172 0|===========================================
-11 149 10|==*===================================
-10 214 132|================================*=====================
-9 178 328|============================================= *
-8 206 340|==================================================== *
-7 113 229|============================= *
-6 58 124|=============== *
-5 31 61|======== *
-4 23 29|====== *
-3 14 13|===*
-2 7 6|=*
-1 4 2|*
0 4 1|*
1 1 0|=
2 2 0|=
3 0 0|
> 4 2 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2113.6008
P(chi-square) = 0
Total sequences searched: 1283
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K
