Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

9 accessions found for Polaromonas naphthalenivorans CJ2  

Data for CP000529  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000529.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000529_3734 CDS_4020115-4018199 73.0 3.1e-21 1
CP000529_0781 CDS_832296-833117 63.2 2.5e-18 1
CP000529_3567 CDS_3823162-3821843 57.5 1.2e-16 1
CP000529_0911 CDS_971955-970615 54.5 8.8e-16 1
CP000529_3492 CDS_3738758-3740191 52.7 3.1e-15 1
CP000529_2616 CDS_2784650-2783244 43.2 1.9e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000529_3734 1/1 422 490 .. 1 70 [] 73.0 3.1e-21
CP000529_0781 1/1 68 135 .. 1 70 [] 63.2 2.5e-18
CP000529_3567 1/1 230 298 .. 1 70 [] 57.5 1.2e-16
CP000529_0911 1/1 250 317 .. 1 70 [] 54.5 8.8e-16
CP000529_3492 1/1 248 324 .. 1 70 [] 52.7 3.1e-15
CP000529_2616 1/1 261 328 .. 1 70 [] 43.2 1.9e-12

Alignments of top-scoring domains:
CP000529_3734: domain 1 of 1, from 422 to 490: score 73.0, E = 3.1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHDs++QsL +k+q++l+r + + + +++ ++alde+
CP000529_3 422 ERTLIARELHDSIAQSLIFLKIQVQLLRSASH-KGQAAQMKQALDEL 467

relarealaevRrllgdLRpaal<-*
+ +re++a+vR+ll ++R+ +
CP000529_3 468 DTGLRESIADVRELLVHFRTRTN 490

CP000529_0781: domain 1 of 1, from 68 to 135: score 63.2, E = 2.5e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E R+ARELHD+++QsL+a+k+ + ++r ++ d+ p+++++ l+ +
CP000529_0 68 EKSRLARELHDELAQSLTALKMDAIWVRDQA--DAWPAMVAAKLTDM 112

relarealaevRrllgdLRpaal<-*
e+++++ a +Rr++ dLRp l
CP000529_0 113 VEMLDRTVAATRRMAADLRPLLL 135

CP000529_3567: domain 1 of 1, from 230 to 298: score 57.5, E = 1.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+ +ARELHD+ gQ+L+ai + + ++r++ ++ ++ +++e ++
CP000529_3 230 ERRALARELHDETGQTLTAIGVTAAYLERHA--AELAAaQIAECAQD 274

irelarealaevRrllgdLRpaal<-*
+r+ +r++ +++R++l +LRp +l
CP000529_3 275 VRRDVRTSREQLRAMLKRLRPHGL 298

CP000529_0911: domain 1 of 1, from 250 to 317: score 54.5, E = 8.8e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER ++ARELHD++g L+a+kl + +++ +l + + +ea e+l+ +
CP000529_0 250 ERGHLARELHDELGALLTAAKLDVARIKSRL--AGNLPEASERLEHL 294

relarealaevRrllgdLRpaal<-*
++++++a Rr++ dLRp+ l
CP000529_0 295 TSTLNTGIALKRRIVEDLRPSSL 317

CP000529_3492: domain 1 of 1, from 248 to 324: score 52.7, E = 3.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ER R ARELHD++ Q L + k le+a+ +l + e+ +++ ++
CP000529_3 248 ERVRVARELHDGIVQVLVSSKFFLETAQLQL--ENRLEglkgqlppv 292

earealdeirelarealaevRrllgdLRpaal<-*
++ l++ e ++eal evRr+ ++LRpa l
CP000529_3 293 QIISPLKRGLERLSEALIEVRRISHALRPALL 324

CP000529_2616: domain 1 of 1, from 261 to 328: score 43.2, E = 1.9e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD+ gQ L++i + + +++ ++ +e+ a + i
CP000529_2 261 ERRCLARELHDEFGQCLTSIGAEAAFITARA--RERQPELLPATQSI 305

relarealaevRrllgdLRpaal<-*
+ + ++ + +l +LRp +l
CP000529_2 306 ASVTAHMMESLQGILCQLRPVGL 328


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-14 7 0|=
-13 58 0|=====
-12 93 45|===*===
-11 186 374|============== *
-10 481 868|=================================== *
-9 790 986|========================================================= *
-8 604 760|============================================ *
-7 573 477|==================================*======
-6 422 270|===================*===========
-5 349 145|==========*==============
-4 220 75|=====*==========
-3 113 38|==*======
-2 69 19|=*===
-1 40 10|*==
0 29 5|*==
1 14 2|*
2 9 1|*
3 9 0|=
4 5 0|=
5 2 0|=
> 6 11 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1513.8931
P(chi-square) = 0

Total sequences searched: 4084

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: