Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

2 accessions found for   

Data for CP000555  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000555.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000555_2596 CDS_2777380-2775893 69.2 4e-20 1
CP000555_1687 CDS_1813899-1811968 68.5 6.2e-20 1
CP000555_1027 CDS_1098864-1097494 63.6 1.7e-18 1
CP000555_0358 CDS_394195-392729 60.7 1.3e-17 1
CP000555_3486 CDS_3705787-3704555 58.6 5.3e-17 1
CP000555_0582 CDS_611666-610482 58.2 7e-17 1
CP000555_2894 CDS_3088368-3089747 55.1 5.6e-16 1
CP000555_0477 CDS_517830-519296 48.7 4.4e-14 1
CP000555_3035 CDS_3236090-3234663 41.7 4.9e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000555_2596 1/1 239 305 .. 1 70 [] 69.2 4e-20
CP000555_1687 1/1 434 502 .. 1 70 [] 68.5 6.2e-20
CP000555_1027 1/1 249 316 .. 1 70 [] 63.6 1.7e-18
CP000555_0358 1/1 282 349 .. 1 70 [] 60.7 1.3e-17
CP000555_3486 1/1 203 269 .. 1 70 [] 58.6 5.3e-17
CP000555_0582 1/1 172 237 .. 1 70 [] 58.2 7e-17
CP000555_2894 1/1 251 318 .. 1 70 [] 55.1 5.6e-16
CP000555_0477 1/1 270 338 .. 1 70 [] 48.7 4.4e-14
CP000555_3035 1/1 267 334 .. 1 70 [] 41.7 4.9e-12

Alignments of top-scoring domains:
CP000555_2596: domain 1 of 1, from 239 to 305: score 69.2, E = 4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+++ARELHD++gQ+L+a+++ +++++r+l + +p e+++ ++ +
CP000555_2 239 ERNHLARELHDELGQHLTALRVDASWLQRRL--AHEP-ELAAVVAGM 282

relarealaevRrllgdLRpaal<-*
e++++ ++evR+ll++LRp +
CP000555_2 283 SEHCSRIQSEVRALLTRLRPLGT 305

CP000555_1687: domain 1 of 1, from 434 to 502: score 68.5, E = 6.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARELHDs++Q+L+ +k+ql+++r +l+ + dp++ + +de+
CP000555_1 434 ERGFIARELHDSIAQALAFMKIQLQMLRGALR-RGDPAATTRVVDEL 479

relarealaevRrllgdLRpaal<-*
+ +re+la+vR+ll ++R+ +
CP000555_1 480 DAGVRESLADVRELLLHFRTRSD 502

CP000555_1027: domain 1 of 1, from 249 to 316: score 63.6, E = 1.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa+++RELHD+ +Q+L +ikl +e a ++ +++p++a+ l+++
CP000555_1 249 ERAHLSRELHDGTSQTLVSIKLLIESAIEQI--EREPAQAAVPLERA 293

relarealaevRrllgdLRpaal<-*
+ + +al+evRr+ ++LRpa l
CP000555_1 294 AVRLADALTEVRRISHRLRPAML 316

CP000555_0358: domain 1 of 1, from 282 to 349: score 60.7, E = 1.3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD+ gQsL+a+ +e++ +l+ +++r +d++
CP000555_0 282 ERRRLARELHDEMGQSLAALWAEAEVVSTLA--GQSLPQLRPSADAM 326

relarealaevRrllgdLRpaal<-*
++ ++ l+ + r+l+dLRp+al
CP000555_0 327 SRTTEHLLEGLQRVLSDLRPPAL 349

CP000555_3486: domain 1 of 1, from 203 to 269: score 58.6, E = 5.3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++g L a+k+ + ++++++ +d ++++ + +
CP000555_3 203 ERTRIAREIHDELGSLLVALKMDVNWLEKRV---ADRLPLAAKCEGM 246

relarealaevRrllgdLRpaal<-*
+l+++a + v r+++dLRp++l
CP000555_3 247 GALIDTAVDKVGRIITDLRPSIL 269

CP000555_0582: domain 1 of 1, from 172 to 237: score 58.2, E = 7e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARE+HD vg sL+a+k l +++r++ +++ +++++++ +
CP000555_0 172 ERTAIAREIHDDVGGSLTALKFDLAWIERHA--RDP--AVAQRAQGA 214

relarealaevRrllgdLRpaal<-*
e++ a++ r+ ++LRpa+l
CP000555_0 215 LETVTLAIESSQRIMHNLRPAIL 237

CP000555_2894: domain 1 of 1, from 251 to 318: score 55.1, E = 5.6e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER ++ARELHD++g L+++kl + ++r++l ++ +ea+++l+ +
CP000555_2 251 ERSHLARELHDELGALLTSAKLDVARLRTHL--PTVTPEAAKRLAHL 295

relarealaevRrllgdLRpaal<-*
e+++ ++a Rr++ dLRp+al
CP000555_2 296 NEALNSGIALKRRIIEDLRPSAL 318

CP000555_0477: domain 1 of 1, from 270 to 338: score 48.7, E = 4.4e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+R+A +LHD+ gQ+L+a++ ++l++r++ ++ ++ e+++ +d+
CP000555_0 270 ERRRLASDLHDEFGQHLTAMSATASLLQRHA--ARFDPvELARCADQ 314

irelarealaevRrllgdLRpaal<-*
+ + + ++R ll++LRp +l
CP000555_0 315 MVASLGCIRLQLRTLLSRLRPHGL 338

CP000555_3035: domain 1 of 1, from 267 to 334: score 41.7, E = 4.9e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD++gQs ++++ + +++++ + +++ea++a++ i
CP000555_3 267 ERRLIARELHDELGQSVTGMRSLALSVAQRV--AIADPEAARAAQVI 311

relarealaevRrllgdLRpaal<-*
++ +++ ++ + l+ +L p +l
CP000555_3 312 ADESSRLYDAMHGLIPRLAPLVL 334


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 5 0|=
-13 33 0|====
-12 63 42|====*==
-11 113 350|============ *
-10 376 812|====================================== *
-9 582 922|==========================================================*
-8 535 710|====================================================== *
-7 558 446|============================================*===========
-6 435 252|=========================*==================
-5 446 135|=============*===============================
-4 250 70|======*==================
-3 149 36|===*===========
-2 99 18|=*========
-1 64 9|*======
0 30 4|*==
1 27 2|*==
2 19 1|*=
3 13 0|==
4 5 0|=
5 2 0|=
6 1 0|=
7 0 0|
8 0 0|
> 9 14 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2904.7258
P(chi-square) = 0

Total sequences searched: 3819

Whole sequence top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: