hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000578.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000578_0821 CDS_965810-963624 66.6 4.2e-23 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000578_0821 1/1 537 618 .. 1 85 [] 66.6 4.2e-23
Alignments of top-scoring domains:
CP000578_0821: domain 1 of 1, from 537 to 618: score 66.6, E = 4.2e-23
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HRVKN+LA+VQ++arQT+ + ++ +++ea gRLq+L++a +
CP000578_0 537 EMEHRVKNILALVQAVARQTFGRIPEASSALEAYGGRLQSLAGAYSH 583
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++W+ A+Lr +++ ++ +g+ ae l+GP+
CP000578_0 584 --LNHESWERASLRHIVATSIGGCGAR-AEAWSLDGPE 618
Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-14 2 0|=
-13 10 0|===
-12 36 0|=========
-11 71 8|=*================
-10 126 108|==========================*=====
-9 216 269|====================================================== *
-8 181 279|============================================== *
-7 163 187|========================================= *
-6 81 102|===================== *
-5 74 50|============*======
-4 26 24|=====*=
-3 26 11|==*====
-2 14 5|=*==
-1 10 2|*==
0 4 1|*
1 2 0|=
2 2 0|=
> 3 8 -|==
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 554.3982
P(chi-square) = 0
Total sequences searched: 1052
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K