Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Mycobacterium sp. JLS  

Data for CP000580  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000580.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000580_0579 CDS_634265-635245 76.5 4.2e-22 1
CP000580_3885 CDS_4144075-4145382 69.3 5.4e-20 1
CP000580_1076 CDS_1160785-1159580 64.4 1.5e-18 1
CP000580_4314 CDS_4593503-4591797 47.1 1.9e-13 1
CP000580_1097 CDS_1181834-1183534 41.0 1.2e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000580_0579 1/1 130 194 .. 1 70 [] 76.5 4.2e-22
CP000580_3885 1/1 237 304 .. 1 70 [] 69.3 5.4e-20
CP000580_1076 1/1 197 263 .. 1 70 [] 64.4 1.5e-18
CP000580_4314 1/1 378 443 .. 1 70 [] 47.1 1.9e-13
CP000580_1097 1/1 376 441 .. 1 70 [] 41.0 1.2e-11

Alignments of top-scoring domains:
CP000580_0579: domain 1 of 1, from 130 to 194: score 76.5, E = 4.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD++gQ+L+++ l l +a d++p+e+r +l+e
CP000580_0 130 ERQRIARELHDEIGQTLTVALLTLKRAV-----DRAPAEIRGELEET 171

relarealaevRrllgdLRpaal<-*
+e++r +l+evR ++++LRp+al
CP000580_0 172 QETVRASLDEVRGIARRLRPDAL 194

CP000580_3885: domain 1 of 1, from 237 to 304: score 69.3, E = 5.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHDsv +L ++++ ++la++ l d+d ++a++ ++e+
CP000580_3 237 ERHRIERDLHDSVQPRLVSLAMAIGLAQTKL--DSDLPAAKQLIAEA 281

relarealaevRrllgdLRpaal<-*
++ a+ al e+R++++++ p++l
CP000580_3 282 HDEAKNALVELRNVVRGIAPTIL 304

CP000580_1076: domain 1 of 1, from 197 to 263: score 64.4, E = 1.5e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A ++HD+++Q+L ++ l++a r++ +dp+ + e+l +
CP000580_1 197 ERRRLAGDIHDGISQRLVTLSYRLDAAVRAI---DDPQVVSEQLGKA 240

relarealaevRrllgdLRpaal<-*
rel+ +l e+R+++++LRp++l
CP000580_1 241 RELVALTLGEARAAISGLRPPVL 263

CP000580_4314: domain 1 of 1, from 378 to 443: score 47.1, E = 1.9e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a+ l l++ ++++ +++ ++++l+
CP000580_4 378 DRDRIARDLHDHVIQRLFAVGLSLQGTLARV--RDA--DVQQRLAGN 420

relarealaevRrllgdLRpaal<-*
+ ++ ++e+R ++ dL+ +
CP000580_4 421 VDDLQAVIQEIRTTIFDLHGGSS 443

CP000580_1097: domain 1 of 1, from 376 to 441: score 41.0, E = 1.2e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+++ l l++ ++ +++ ++++l e
CP000580_1 376 DRDRIARDLHDQVIQRLFGVGLTLQGTIPRA--RTP--DVQRRLIES 418

relarealaevRrllgdLRpaal<-*
+ ++e ++++R ++ dL+ +
CP000580_1 419 VDDLQEVIQQIRTAIFDLQGGSS 441


Histogram of all scores:
score obs exp (one = represents 16 sequences)
----- --- ---
-14 8 0|=
-13 43 0|===
-12 106 64|===*===
-11 153 525|========== *
-10 537 1220|================================== *
-9 881 1385|======================================================== *
-8 894 1068|======================================================== *
-7 865 671|=========================================*=============
-6 685 380|=======================*===================
-5 666 203|============*=============================
-4 360 106|======*================
-3 212 54|===*==========
-2 136 27|=*=======
-1 75 14|*====
0 43 7|*==
1 28 3|*=
2 17 1|*=
3 8 0|=
4 8 0|=
5 4 0|=
6 2 0|=
7 1 0|=
8 1 0|=
9 0 0|
10 0 0|
> 11 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 4144.8052
P(chi-square) = 0

Total sequences searched: 5739

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: