Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Rhodospirillum centenum SW  

Data for CP000613  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000613.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000613_2992 CDS_3131803-3133428 130.0 8.7e-37 1
CP000613_2585 CDS_2724460-2726298 120.4 4.5e-34 1
CP000613_1996 CDS_2107115-2105610 119.5 8.3e-34 1
CP000613_1432 CDS_1516459-1517190 59.9 7.4e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000613_2992 1/1 340 428 .. 1 94 [] 130.0 8.7e-37
CP000613_2585 1/1 411 496 .. 1 94 [] 120.4 4.5e-34
CP000613_1996 1/1 305 393 .. 1 94 [] 119.5 8.3e-34
CP000613_1432 1/1 53 122 .. 1 75 [. 59.9 7.4e-17

Alignments of top-scoring domains:
CP000613_2992: domain 1 of 1, from 340 to 428: score 130.0, E = 8.7e-37
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
IHHRVKNNLQv SLL++Qa +f+d++v + a+ ++q R +S
CP000613_2 340 DIHHRVKNNLQVTVSLLMIQAGRFTDPAV-----RTAFADTQERLQS 381

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+ l+HE LY+s+ + +vd++ Y+++L++ L ++yg gi L+lDl
CP000613_2 382 IGLLHEVLYQSDTVARVDLAGYIRRLAGALADAYGAAERGIGLDLDL 428

CP000613_2585: domain 1 of 1, from 411 to 496: score 120.4, E = 4.5e-34
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ++SSLLrLQa + e + +++s +R++S
CP000613_2 411 EVHHRVKNNLQLVSSLLRLQAMRLPAEL------RQGFEDSLSRIQS 451

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+HE LY++ ++vdf++Yl++L+ L +++ + d+i ++ +
CP000613_2 452 MSLVHELLYRTNQPSRVDFADYLRRLAPTLAECFLPDPDRIAIE--V 496

CP000613_1996: domain 1 of 1, from 305 to 393: score 119.5, E = 8.3e-34
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+ Q I+ +++LQ+ ++ d +v +e+L +R+++
CP000613_1 305 EMNHRVFNSFQRIATIVSLQSARSADAAV-----KEHLGKIYHRIQT 346

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m l+H++LY ++++d++d++ Yl++L++++ q +++++d +++++D+
CP000613_1 347 MGLVHRRLYSGRSVDRIDLGGYLTELCADIQQVMADKDDQWRIEADC 393

CP000613_1432: domain 1 of 1, from 53 to 122: score 59.9, E = 7.4e-17
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HR KN+LQ+++SLLrLQ ++++d+ + ++a + +RV
CP000613_1 53 EMQHRAKNSLQLVISLLRLQHHRISDPTA-----RAAYDQTMHRVEV 94

mAliHEeLYksedldtvdfseYlekLte<-*
A+++++ +++++ +vd+ Yl++++e
CP000613_1 95 LAILYRQVHETRSETQVDLPRYLREVCE 122


Histogram of all scores:
score obs exp (one = represents 19 sequences)
----- --- ---
-15 25 0|==
-14 47 0|===
-13 91 25|=*===
-12 301 262|=============*==
-11 1121 731|======================================*====================
-10 854 947|============================================= *
-9 588 799|=============================== *
-8 447 536|======================== *
-7 211 318|============ *
-6 171 177|=========*
-5 68 95|====*
-4 34 50|==*
-3 17 26|=*
-2 7 13|*
-1 4 7|*
0 2 3|*
1 1 1|*
2 2 1|*
3 2 0|=
> 4 9 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 523.1960
P(chi-square) = 0

Total sequences searched: 4041

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: