Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Rhodospirillum centenum SW  

Data for CP000613  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000613.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000613_2072 CDS_2192468-2190501 147.3 5.1e-50 1
CP000613_2347 CDS_2476333-2474531 128.4 1.4e-43 1
CP000613_0324 CDS_352570-349577 111.3 9.6e-38 1
CP000613_0886 CDS_957141-958880 103.8 3.4e-35 1
CP000613_3831 CDS_4110021-4112402 98.5 2.2e-33 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000613_2072 1/1 450 532 .. 1 85 [] 147.3 5.1e-50
CP000613_2347 1/1 406 484 .. 1 85 [] 128.4 1.4e-43
CP000613_0324 1/1 671 749 .. 1 85 [] 111.3 9.6e-38
CP000613_0886 1/1 391 467 .. 1 85 [] 103.8 3.4e-35
CP000613_3831 1/1 610 686 .. 1 85 [] 98.5 2.2e-33

Alignments of top-scoring domains:
CP000613_2072: domain 1 of 1, from 450 to 532: score 147.3, E = 5.1e-50
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+V Si +QT+R++a+l +f+ +F+gRL+ALs++H+L
CP000613_2 450 ELSHRVKNTLATVISIGAQTRRRHAELTSFWPTFEGRLRALSATHNL 496

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +++W++++L+e++++e++Py+g+++++++lsGP+
CP000613_2 497 --LADHHWEWVRLSEVVSHEVRPYAGPGGTDVRLSGPA 532

CP000613_2347: domain 1 of 1, from 406 to 484: score 128.4, E = 1.4e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLAvVQ +a+QTl++a++l+ef +aF gRL AL+raH+L
CP000613_2 406 ELSHRVKNTLAVVQVLAAQTLHRATTLAEFGDAFHGRLEALARAHGL 452

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ r++W g+dLr+L+e+eLaP+ ++R+ ++GP+
CP000613_2 453 --VLRAHWNGVDLRALAEEELAPH----EGRVSIEGPA 484

CP000613_0324: domain 1 of 1, from 671 to 749: score 111.3, E = 9.6e-38
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR KN LAvVQ+++r T aa+++ef++a++gR+ A++raH+L
CP000613_0 671 EVDHRAKNVLAVVQAVVRLT--EAATPEEFAAAVEGRIGAMARAHSL 715

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L W+g+dL+ L++ eLa+ ++ ++Ri ++G +
CP000613_0 716 --LAVGGWSGVDLGRLVADELAAWED--GDRIAVTGTP 749

CP000613_0886: domain 1 of 1, from 391 to 467: score 103.8, E = 3.4e-35
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR KN LAvVQ+++ T +a+s+++f++a++gR A++raH+L
CP000613_0 391 EVDHRAKNALAVVQALVGLT--SADSVAAFKQAVTGRVSAMARAHSL 435

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +W g+dL+ L+ +eL+Py a+R+++ GP+
CP000613_0 436 --LAANRWLGGDLAGLAGEELEPY----AGRVHMAGPA 467

CP000613_3831: domain 1 of 1, from 610 to 686: score 98.5, E = 2.2e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR KN LAvV+S++r T + ++++ f +a++gR +AL+raH+L
CP000613_3 610 EVDHRAKNALAVVSSVVRLT--RQDTVEGFIDALDGRVAALARAHSL 654

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +++W g++L+ L++aeLa+y ++ +lsGP+
CP000613_3 655 --LAQERWTGGELGTLAAAELAAY----GDAARLSGPR 686


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 12 0|=
-13 38 0|===
-12 267 0|=====================
-11 296 32|==*====================
-10 495 413|===============================*=======
-9 710 1024|======================================================= *
-8 712 1063|======================================================= *
-7 581 714|============================================= *
-6 342 389|=========================== *
-5 210 193|==============*==
-4 132 91|======*====
-3 90 42|===*===
-2 39 19|=*=
-1 29 8|*==
0 16 4|*=
1 9 1|*
2 8 0|=
3 4 0|=
4 2 0|=
5 2 0|=
> 6 8 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2515.3711
P(chi-square) = 0

Total sequences searched: 4041

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: