hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000614.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000614_1513 CDS_1652216-1653655 67.0 1.5e-19 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000614_1513 1/1 272 340 .. 1 70 [] 67.0 1.5e-19
Alignments of top-scoring domains:
CP000614_1513: domain 1 of 1, from 272 to 340: score 67.0, E = 1.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI+RELHD +gQ+L+a+k++l ++ ++ d +++ ++a++ +d +
CP000614_1 272 EKKRISRELHDDLGQQLTALKMGLNRLVTQDD-ATPSAQAAQLADSM 317
relarealaevRrllgdLRpaal<-*
r+++++a+ vRrl +LRpa+l
CP000614_1 318 RAALDRAILSVRRLSAGLRPAIL 340
Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 9 0|=
-13 32 0|====
-12 65 36|===*===
-11 142 300|=============== *
-10 378 696|====================================== *
-9 569 790|========================================================= *
-8 473 609|================================================ *
-7 466 383|======================================*========
-6 386 216|=====================*=================
-5 311 116|===========*====================
-4 172 60|=====*============
-3 99 31|===*======
-2 67 15|=*=====
-1 38 8|*===
0 25 4|*==
1 12 2|*=
2 14 1|*=
3 6 0|=
4 3 0|=
5 1 0|=
6 2 0|=
7 1 0|=
8 0 0|
9 1 0|=
10 0 0|
11 0 0|
> 12 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1443.8457
P(chi-square) = 0
Total sequences searched: 3274
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K