hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000616.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000616_0206 CDS_241572-246563 134.1 1.6e-38 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000616_0206 1/1 1468 1556 .. 1 94 [] 134.1 1.6e-38
Alignments of top-scoring domains:
CP000616_0206: domain 1 of 1, from 1468 to 1556: score 134.1, E = 1.6e-38
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+ISSLL+LQa++++d++v e++ +s+nRV+S
CP000616_0 1468 EVHHRVKNNLQLISSLLNLQAERVTDKAV-----AELFADSRNRVRS 1509
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA++HE LY+ +++ ++ + + ++ L+++L + y g+ g++L D+
CP000616_0 1510 MAMVHENLYRAGNFARIAMTAHVKTLCGHLARVYDMGRLGVDLQIDV 1556
Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-15 3 0|=
-14 6 0|=
-13 28 6|*====
-12 76 73|============*
-11 319 203|=================================*====================
-10 274 263|===========================================*==
-9 163 222|============================ *
-8 100 149|================= *
-7 54 88|========= *
-6 38 49|======= *
-5 18 26|=== *
-4 17 14|==*
-3 6 7|=*
-2 4 3|*
-1 5 2|*
0 0 1|*
1 1 0|=
> 2 2 -|=
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 181.3152
P(chi-square) = 1.249e-33
Total sequences searched: 1114
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K
