Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

5 accessions found for Agrobacterium radiobacter K84  

Data for CP000628  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000628.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000628_2596 CDS_2747092-2748198 131.5 1.2e-44 1
CP000628_2936 CDS_3102230-3103960 78.0 2e-26 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000628_2596 1/1 172 254 .. 1 85 [] 131.5 1.2e-44
CP000628_2936 1/1 381 462 .. 1 85 [] 78.0 2e-26

Alignments of top-scoring domains:
CP000628_2596: domain 1 of 1, from 172 to 254: score 131.5, E = 1.2e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+LA++Q+ia+QT+R++ ++d f+ +F+gRLq+Ls+++dL
CP000628_2 172 ELSHRSKNLLAIIQGIATQTARHTLTIDNFLIKFRGRLQSLSNSQDL 218

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA L+eL+e ++aPy+++++ + G +
CP000628_2 219 --ITDSSWRGAYLFELAEKQFAPYWPDAGVPMPIYGIN 254

CP000628_2936: domain 1 of 1, from 381 to 462: score 78.0, E = 2e-26
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR KN+LA+ Q++ rQ +R+++s+d f +a+++RL L+r+ +
CP000628_2 381 ELVHRTKNLLALAQAMTRQLARQTDSVDTFQRAVADRLEGLARSIEV 427

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++W+g++Lr ++ + La + ++ ++++ +sG d
CP000628_2 428 --LTSEQWSGVSLRRVIDIHLATFLQA-PQQLDISGQD 462


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 9 0|=
-13 63 0|======
-12 299 0|=========================
-11 383 30|==*=============================
-10 651 387|================================*======================
-9 642 958|====================================================== *
-8 680 994|========================================================= *
-7 425 668|==================================== *
-6 225 364|=================== *
-5 158 180|==============*
-4 90 85|=======*
-3 61 39|===*==
-2 22 18|=*
-1 13 8|*=
0 8 3|*
1 6 1|*
2 5 0|=
> 3 4 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4602.4438
P(chi-square) = 0

Total sequences searched: 3744

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: