Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Agrobacterium vitis S4  

Data for CP000633  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000633.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000633_0701 CDS_797651-798655 114.9 4.4e-39 1
CP000633_2547 CDS_2893645-2896203 92.1 2.6e-31 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000633_0701 1/1 146 227 .. 1 85 [] 114.9 4.4e-39
CP000633_2547 1/1 519 599 .. 1 85 [] 92.1 2.6e-31

Alignments of top-scoring domains:
CP000633_0701: domain 1 of 1, from 146 to 227: score 114.9, E = 4.4e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HRVKN LA+VQSi+ QT R+a+sl++++ +s+R+qALs a+dL
CP000633_0 146 ELAHRVKNMLAMVQSIVGQTMRGAQSLPQAASLVSARIQALSKAQDL 192

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt + a+Ad++e++e +++P+++ ++R+++ GP+
CP000633_0 193 --LTGKSVASADIAEVVENAIEPHRDR-PDRFQVVGPS 227

CP000633_2547: domain 1 of 1, from 519 to 599: score 92.1, E = 2.6e-31
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LAv+ S++ R++ l ++v+++ gR +ALs aHd+
CP000633_2 519 ELNHRVKNILAVIKSLIGVPTRPEHQLRDYVTSLKGRVHALSHAHDQ 565

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ r + +++ L+eLl+aeL+Py++e ++ i l GP
CP000633_2 566 --VIRGS-GSGQLSELLQAELGPYRTE-GTAIALGGPM 599


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-15 1 0|=
-14 5 0|=
-13 39 0|====
-12 243 0|=========================
-11 338 26|==*===============================
-10 513 334|=================================*==================
-9 579 827|==========================================================*
-8 572 859|==========================================================*
-7 365 577|===================================== *
-6 226 315|======================= *
-5 155 156|===============*
-4 92 73|=======*==
-3 50 34|===*=
-2 26 15|=*=
-1 17 7|*=
0 3 3|*
1 3 1|*
> 2 7 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4073.7195
P(chi-square) = 0

Total sequences searched: 3234

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: