Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Agrobacterium vitis S4  

Data for CP000634  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000634.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000634_0815 CDS_1003641-1002646 136.9 4.7e-47 1
CP000634_0442 CDS_538287-536254 114.9 1.4e-39 1
CP000634_0486 CDS_604066-605124 114.1 2.7e-39 1
CP000634_0484 CDS_600415-602313 104.1 6.8e-36 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000634_0815 1/1 138 220 .. 1 85 [] 136.9 4.7e-47
CP000634_0442 1/1 488 567 .. 1 85 [] 114.9 1.4e-39
CP000634_0486 1/1 160 239 .. 1 85 [] 114.1 2.7e-39
CP000634_0484 1/1 405 484 .. 1 85 [] 104.1 6.8e-36

Alignments of top-scoring domains:
CP000634_0815: domain 1 of 1, from 138 to 220: score 136.9, E = 4.7e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN+LA++QSia QT+R +++ld+f+++F+gRL+ALs ++dL
CP000634_0 138 EVSHRSKNLLAIIQSIAFQTARYSGTLDQFLGKFRGRLHALSMSQDL 184

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA + +L++++L+ y +e a +++sG++
CP000634_0 185 --ITDSSWRGAYFQDLVRQQLEKYVPETANLVQVSGDN 220

CP000634_0442: domain 1 of 1, from 488 to 567: score 114.9, E = 1.4e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KNtLA+VQ+ia QTl+ s +e+v aF +RL+AL++aHd+
CP000634_0 488 ELSHRLKNTLAMVQAIAGQTLK-DVSEKEAVNAFLARLHALGAAHDV 533

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L r +W+ A +r+++e La +++ ++Ri ++GPd
CP000634_0 534 --LLRQNWSAAKMRDVIEKVLALHAD--GDRIYVDGPD 567

CP000634_0486: domain 1 of 1, from 160 to 239: score 114.1, E = 2.7e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA+V Si+r+T+R+a+sld+++++F gRL ALs++H
CP000634_0 160 ELNHRVKNILATVTSIFRMTRRGAESLDDLATDFNGRLLALSNVHTA 206

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++++ ++ ++L++++ ++Pyg eRi ++G d
CP000634_0 207 --VFEAGGEDVSLSAVVDLIVSPYG---TERIAVDGSD 239

CP000634_0484: domain 1 of 1, from 405 to 484: score 104.1, E = 6.8e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HRVKNt+A++Q+iarQT++ + + ++ F+ R +AL++a d+
CP000634_0 405 ELAHRVKNTMAMIQAIARQTFK---DRSQENGVFARRVAALAGAYDI 448

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++W +A Lr++le++L+P+++e+++Ri+l+G +
CP000634_0 449 --LLSEDWKSAGLRDVLERALQPFDSEGDRRIVLQGAA 484


Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-13 6 0|==
-12 53 0|==============
-11 93 8|=*======================
-10 149 109|===========================*==========
-9 197 269|================================================== *
-8 202 280|=================================================== *
-7 141 188|==================================== *
-6 88 102|====================== *
-5 59 50|============*==
-4 25 24|=====*=
-3 15 11|==*=
-2 8 5|=*
-1 7 2|*=
0 4 1|*
1 1 0|=
2 0 0|
> 3 6 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 900.9031
P(chi-square) = 0

Total sequences searched: 1054

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: