Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Agrobacterium vitis S4  

Data for CP000636  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000636.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000636_0014 CDS_17995-17042 84.1 4.3e-25 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000636_0014 1/1 162 250 .. 1 94 [] 84.1 4.3e-25

Alignments of top-scoring domains:
CP000636_0014: domain 1 of 1, from 162 to 250: score 84.1, E = 4.3e-25
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRVKNN Q+I++L+r++ar+++ e+ e + +R+ +
CP000636_0 162 ELQHRVKNNFQMITALIRMEARNVQHSEA-----SERFAQLAGRIEA 203

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
Al+++ L+ e +t+d+++Y++ ++++ + +++v++++++ k+D+
CP000636_0 204 LALLYRSLSDEEKCGTIDLGSYVNQIAASVMTAHAVEGIRLDMKVDT 250


Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-14 1 0|=
-13 2 1|*=
-12 10 11|==========*
-11 55 32|===============================*=======================
-10 33 42|================================= *
-9 31 35|=============================== *
-8 23 23|======================*
-7 11 14|=========== *
-6 6 7|======*
-5 1 4|= *
> -4 5 -|=====


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 19.4864
P(chi-square) = 0.003416

Total sequences searched: 178

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: