Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

6 accessions found for Rhodobacter sphaeroides ATCC 17025  

Data for CP000661  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000661.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000661_2242 CDS_2302780-2299283 92.0 2.7e-31 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000661_2242 1/1 959 1039 .. 1 85 [] 92.0 2.7e-31

Alignments of top-scoring domains:
CP000661_2242: domain 1 of 1, from 959 to 1039: score 92.0, E = 2.7e-31
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKN L++V ++++ +R ++++e +e++++R++AL+++H+L
CP000661_2 959 ELQHRVKNMLSNVIALVNRARREQGDPQEILETLAQRIRALANTHNL 1005

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++Wa+ Lr++l+ eL g +eR+ l GPd
CP000661_2 1006 --LTAENWASTALRDILALELLNVYG--EERVMLRGPD 1039


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 1 0|=
-13 40 0|====
-12 179 0|==================
-11 291 25|==*===========================
-10 402 321|================================*========
-9 576 796|==========================================================*
-8 562 826|========================================================= *
-7 410 555|========================================= *
-6 241 303|========================= *
-5 166 150|==============*==
-4 92 71|=======*==
-3 60 33|===*==
-2 42 15|=*===
-1 19 6|*=
0 13 3|*=
1 4 1|*
2 3 0|=
3 3 0|=
4 2 0|=
> 5 5 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3088.3521
P(chi-square) = 0

Total sequences searched: 3111

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: