Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

6 accessions found for Rhodobacter sphaeroides ATCC 17025  

Data for CP000662  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000662.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000662_0174 CDS_185350-186792 108.7 1.4e-37 1
CP000662_0507 CDS_556880-554679 81.3 3.1e-28 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000662_0174 1/1 292 374 .. 1 85 [] 108.7 1.4e-37
CP000662_0507 1/1 536 617 .. 1 85 [] 81.3 3.1e-28

Alignments of top-scoring domains:
CP000662_0174: domain 1 of 1, from 292 to 374: score 108.7, E = 1.4e-37
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+V+Si r T + +++l+ + aF++R+qAL+++H+L
CP000662_0 292 ELDHRVKNTLALVMSISRRTMHYEDTLEGYQKAFTARIQALAATHNL 338

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +W ++r++l +eLaPy+ +++R+t++ d
CP000662_0 339 --LAAKSWNDISIRDILLRELAPYNEGQSRRVTIEVFD 374

CP000662_0507: domain 1 of 1, from 536 to 617: score 81.3, E = 3.1e-28
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HRVKN+LA+VQ++arQ++ + ++ + +++aF gRLqAL++a +
CP000662_0 536 EMDHRVKNILALVQAVARQSFGGIPEAAKARDAFYGRLQALAGAYSH 582

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++Wa A+Lr+++ +a +g++ ae +tl+GPd
CP000662_0 583 --LRHESWAQASLRQIIGTSVAGCGAN-AEAVTLDGPD 617


Histogram of all scores:
score obs exp (one = represents 3 sequences)
----- --- ---
-13 11 0|====
-12 44 0|===============
-11 73 6|=*=======================
-10 97 82|===========================*=====
-9 169 205|========================================================= *
-8 126 213|========================================== *
-7 97 143|================================= *
-6 67 78|======================= *
-5 48 38|============*===
-4 19 18|=====*=
-3 16 8|==*===
-2 15 3|*====
-1 7 1|*==
0 5 0|==
1 1 0|=
2 1 0|=
> 3 6 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 743.3080
P(chi-square) = 0

Total sequences searched: 802

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: