Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Salinispora tropica CNB-440  

Data for CP000667  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000667.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000667_1775 CDS_2054375-2053155 90.6 2.3e-26 1
CP000667_4127 CDS_4748874-4750097 88.6 8.9e-26 1
CP000667_4075 CDS_4696958-4698163 82.9 4.2e-24 1
CP000667_2420 CDS_2765385-2764231 76.1 4.4e-22 1
CP000667_0396 CDS_457216-455942 75.7 5.6e-22 1
CP000667_2714 CDS_3103236-3104537 61.3 1e-17 1
CP000667_1559 CDS_1794508-1792787 60.0 2.4e-17 1
CP000667_3227 CDS_3761087-3762778 59.2 4.2e-17 1
CP000667_0354 CDS_405903-404587 42.9 2.6e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000667_1775 1/1 199 266 .. 1 70 [] 90.6 2.3e-26
CP000667_4127 1/1 181 248 .. 1 70 [] 88.6 8.9e-26
CP000667_4075 1/1 197 265 .. 1 70 [] 82.9 4.2e-24
CP000667_2420 1/1 184 250 .. 1 70 [] 76.1 4.4e-22
CP000667_0396 1/1 205 272 .. 1 70 [] 75.7 5.6e-22
CP000667_2714 1/1 235 302 .. 1 70 [] 61.3 1e-17
CP000667_1559 1/1 381 447 .. 1 70 [] 60.0 2.4e-17
CP000667_3227 1/1 352 419 .. 1 70 [] 59.2 4.2e-17
CP000667_0354 1/1 240 307 .. 1 70 [] 42.9 2.6e-12

Alignments of top-scoring domains:
CP000667_1775: domain 1 of 1, from 199 to 266: score 90.6, E = 2.3e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++ s++ +q+ ++rr+l d+dp++ar+al+++
CP000667_1 199 ERVRIARELHDVVAHHVSVMGVQAAACRRVL--DRDPAKARTALAAV 243

relarealaevRrllgdLRpaal<-*
+e ar+a +e+Rr+lg+LR ++
CP000667_1 244 EESARTAVDELRRMLGVLRARDH 266

CP000667_4127: domain 1 of 1, from 181 to 248: score 88.6, E = 8.9e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v+++++++++q++++r + d+dp+ area++ +
CP000667_4 181 ERTRIARELHDVVAHTMAVMIVQADGVRFTI--DRDPAIAREAAKVV 225

relarealaevRrllgdLRpaal<-*
++++r+al+e+Rrl+ +LR++
CP000667_4 226 ADTGRQALEEMRRLVNVLREPSR 248

CP000667_4075: domain 1 of 1, from 197 to 265: score 82.9, E = 4.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD v++sL +i+lq+++a r++ ++ pe+area+++i
CP000667_4 197 ERLRIARDLHDMVAHSLGVIALQAGAAGRVM--HTQPEAAREAIHNI 241

relarealaevRrllgdLR.paal<-*
++ ++e+l+ +Rr+++ LR+ + +
CP000667_4 242 EKVGQETLSGLRRVVSSLRnVDPD 265

CP000667_2420: domain 1 of 1, from 184 to 250: score 76.1, E = 4.4e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v ++ +a+ +q+e+ar+l ++pe+++++l+++
CP000667_2 184 ERTRIARELHDVVTHHVTAMVVQAEAARYLS---SAPERLDQTLAAV 227

relarealaevRrllgdLRpaal<-*
+++r+a++++R ll L p++
CP000667_2 228 SDTGRRAITDLRYLLDLLDPDDG 250

CP000667_0396: domain 1 of 1, from 205 to 272: score 75.7, E = 5.6e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++++++s+++l++++++ + d+ pee+++a+ i
CP000667_0 205 ERTRIAREMHDVLAHRISLLSLHAGALEFRP--DASPEEVARAAGVI 249

relarealaevRrllgdLRpaal<-*
r+ a+ al+++R+++g+LR +
CP000667_0 250 RGSAHAALRDLREVIGVLRAETG 272

CP000667_2714: domain 1 of 1, from 235 to 302: score 61.3, E = 1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L ai ++l++a r+l +++p++a++ l +
CP000667_2 235 ELRRIERDLHDGAQARLVAIGMKLGAATRQL--HTNPDAAETLLVDA 279

relarealaevRrllgdLRpaal<-*
r + +al+e+R l+++++p++l
CP000667_2 280 RNATATALEELRCLIRGIHPPVL 302

CP000667_1559: domain 1 of 1, from 381 to 447: score 60.0, E = 2.4e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+RIAR+LHD+v Q+L+a lql+ a + +++ e++ ++ ++
CP000667_1 381 DRERIARDLHDVVIQRLFATGLQLQSAVPMS--TRP--ELANRINAA 423

relarealaevRrllgdLR.paal<-*
+ ++ +++++Rr++ +LR+p++
CP000667_1 424 VDDLDATIKDIRRTIFELRtPMTA 447

CP000667_3227: domain 1 of 1, from 352 to 419: score 59.2, E = 4.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+v+Q L ++ +++ a++ + ++d ee +e l+ +
CP000667_3 352 ERQRLAREIHDGVAQELVMVGYGIDNALATV--HEDTEETAESLRGL 396

relarealaevRrllgdLRpaal<-*
r+ + + ++e+R l +LR ++
CP000667_3 397 RQEVTRVITELRLSLFELRSEVD 419

CP000667_0354: domain 1 of 1, from 240 to 307: score 42.9, E = 2.6e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+ + R++HD+ Q+L +++ l++ar +l +++p +ar++lde+
CP000667_0 240 ALRKLERDIHDGPQQRLVRLAMDLSRAREQL--TSNPVAARDTLDEA 284

relarealaevRrllgdLRpaal<-*
+ re+l+e+R+l +++ p++l
CP000667_0 285 VDQTRETLTELRALSRGIAPPIL 307


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 3 0|=
-13 27 0|===
-12 68 50|====*=
-11 115 415|========== *
-10 341 964|============================= *
-9 623 1095|==================================================== *
-8 642 844|====================================================== *
-7 659 530|============================================*==========
-6 567 300|========================*=======================
-5 574 161|=============*==================================
-4 343 84|======*======================
-3 198 43|===*=============
-2 142 22|=*==========
-1 90 11|*=======
0 53 5|*====
1 24 2|*=
2 21 1|*=
3 13 0|==
4 5 0|=
5 4 0|=
6 4 0|=
7 1 0|=
8 4 0|=
9 2 0|=
10 1 0|=
11 1 0|=
12 1 0|=
> 13 10 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 5147.1299
P(chi-square) = 0

Total sequences searched: 4536

Whole sequence top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: