Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

1 accessions found for Roseiflexus sp. RS-1  

Data for CP000686  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000686.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000686_3335 CDS_4292961-4294283 91.0 1.8e-26 1
CP000686_4157 CDS_5340126-5341403 86.7 3.1e-25 1
CP000686_1927 CDS_2463933-2465342 83.0 3.9e-24 1
CP000686_0438 CDS_574772-572445 79.3 4.8e-23 1
CP000686_0245 CDS_323173-321398 71.1 1.2e-20 1
CP000686_3673 CDS_4704645-4705721 67.8 1.2e-19 1
CP000686_0905 CDS_1159453-1158362 64.0 1.6e-18 1
CP000686_2348 CDS_2985349-2986986 62.9 3.3e-18 1
CP000686_4174 CDS_5363162-5362233 53.1 2.6e-15 1
CP000686_4390 CDS_5645213-5646388 52.8 3.1e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000686_3335 1/1 230 297 .. 1 70 [] 91.0 1.8e-26
CP000686_4157 1/1 218 285 .. 1 70 [] 86.7 3.1e-25
CP000686_1927 1/1 260 327 .. 1 70 [] 83.0 3.9e-24
CP000686_0438 1/1 173 240 .. 1 70 [] 79.3 4.8e-23
CP000686_0245 1/1 390 457 .. 1 70 [] 71.1 1.2e-20
CP000686_3673 1/1 149 216 .. 1 70 [] 67.8 1.2e-19
CP000686_0905 1/1 159 230 .. 1 70 [] 64.0 1.6e-18
CP000686_2348 1/1 342 409 .. 1 70 [] 62.9 3.3e-18
CP000686_4174 1/1 65 130 .. 3 70 .] 53.1 2.6e-15
CP000686_4390 1/1 187 252 .. 1 70 [] 52.8 3.1e-15

Alignments of top-scoring domains:
CP000686_3335: domain 1 of 1, from 230 to 297: score 91.0, E = 1.8e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+AR++HD++g+ L+ +++ql++a+rll ++dp++a++ ++++
CP000686_3 230 ERVRLARDIHDGLGHYLTILNVQLQAAARLL--QRDPQRAAAVIATC 274

relarealaevRrllgdLRpaal<-*
re a++al+evRr + +++p+ l
CP000686_3 275 REVAQTALEEVRRSVAAMQPSPL 297

CP000686_4157: domain 1 of 1, from 218 to 285: score 86.7, E = 3.1e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR++HD +g++L+a+++qle+ +rl+ + dp++a++++d++
CP000686_4 218 ERERIARDMHDYLGHTLAALSVQLEATQRLY--RVDPQRADAQIDAM 262

relarealaevRrllgdLRpaal<-*
++ +re++a +Rr++ +LR+++l
CP000686_4 263 KTQVRESMAALRRTIAGLRTPGL 285

CP000686_1927: domain 1 of 1, from 260 to 327: score 83.0, E = 3.9e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD+++QsL+ +++ ++l + + + dp+++r++l e+
CP000686_1 260 ERARIARDIHDGIAQSLAFMRMRVDLWLDWI--EHDPQRLRAELLEL 304

relarealaevRrllgdLRpaal<-*
++++re ++e+Rr++ +LRp ++
CP000686_1 305 KTTLREQIRELRRAIFALRPVQF 327

CP000686_0438: domain 1 of 1, from 173 to 240: score 79.3, E = 4.8e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR+LHD++ Q+L++i++ + +a+ l + dpe+a+++++ +
CP000686_0 173 ERNRLARDLHDTIKQQLFSINVAAATAQSLR--HHDPEAAAQHIRHV 217

relarealaevRrllgdLRpaal<-*
r+l++ a+ae+ +ll++LRp+ l
CP000686_0 218 RDLSQAAMAEMKALLTQLRPQPL 240

CP000686_0245: domain 1 of 1, from 390 to 457: score 71.1, E = 1.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ +AR+LHD+ +Q+L+ai++ +e ++rll d+dp+++ +ld +
CP000686_0 390 VRHQLARDLHDGPAQALAAITMNVEFIKRLL--DRDPQRVLPELDKL 434

relarealaevRrllgdLRpaal<-*
+la+++ evR +l +LRp al
CP000686_0 435 GQLAKRTTHEVRTMLFELRPLAL 457

CP000686_3673: domain 1 of 1, from 149 to 216: score 67.8, E = 1.2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI+ +HD+ +Qs+s + l +e ++rll d+d e+ar++l ++
CP000686_3 149 ERLRISLQMHDGPAQSMSNLVLRAEICQRLL--DRDVEMARAELGAL 193

relarealaevRrllgdLRpaal<-*
+ +++ +l+++Rr + dLRp++l
CP000686_3 194 KNAINATLQDTRRFIFDLRPMIL 216

CP000686_0905: domain 1 of 1, from 159 to 230: score 64.0, E = 1.6e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrllds..dkdpeeareald
ER R+ARE HD+ +Q L+ + le++ +l+++++ + +e++++ ld
CP000686_0 159 ERVRLAREVHDGPAQVLANSLMLLETCYTLAQQqtGEQAEKLAQMLD 205

eirelarealaevRrllgdLRpaal<-*
++r + r++l+evRr + +LRp++
CP000686_0 206 RLRSATRDGLSEVRRFIANLRPGQV 230

CP000686_2348: domain 1 of 1, from 342 to 409: score 62.9, E = 3.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
Ra IAR+LHD+ Qs +ai++ +e +++ll ++ pe+++ +l +
CP000686_2 342 VRAAIARDLHDGPTQSVAAIAMNIEFIKKLL--RAMPERVESELNVL 386

relarealaevRrllgdLRpaal<-*
++l++++ ++R ll +LRp +l
CP000686_2 387 ADLVQKTAYDIRTLLFELRPLGL 409

CP000686_4174: domain 1 of 1, from 65 to 130: score 53.1, E = 2.6e-15
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeire
+ IARELHD+v+Q+++a+ l+l+ + ++ + +e rea++++ e
CP000686_4 65 RQIARELHDGVAQHITAAYLHLQSLSDIY--RPRSPESREAFARAIE 109

larealaevRrllgdLRpaal<-*
l r+a +evRr++++ pa l
CP000686_4 110 LTRRAADEVRRVITGSPPAPL 130

CP000686_4390: domain 1 of 1, from 187 to 252: score 52.8, E = 3.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD Q+ +i l l +a+r ++++e r++++++
CP000686_4 187 ERLRIARDLHDDAVQQVYSIVLLLKGALR----HSADEGGRQEVQRV 229

relarealaevRrllgdLRpaal<-*
+ a +a + +Rr l+dLR++ +
CP000686_4 230 YAQAVQAWEGLRRYLRDLRDPLD 252


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 3 0|=
-13 19 0|==
-12 53 50|====*
-11 78 413|======== *
-10 374 960|================================== *
-9 639 1090|==========================================================*
-8 588 840|====================================================== *
-7 631 528|===============================================*==========
-6 538 299|===========================*=====================
-5 636 160|==============*===========================================
-4 316 83|=======*=====================
-3 221 43|===*=================
-2 150 22|=*============
-1 85 11|*=======
0 51 5|*====
1 45 2|*====
2 27 1|*==
3 18 0|==
4 9 0|=
5 7 0|=
6 3 0|=
7 7 0|=
8 2 0|=
9 1 0|=
10 0 0|
11 2 0|=
> 12 14 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 5483.5542
P(chi-square) = 0

Total sequences searched: 4517

Whole sequence top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: