Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

1 accessions found for Dehalococcoides sp. BAV1  

Data for CP000688  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000688.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000688_0934 CDS_936422-932733 67.9 3.3e-20 1
CP000688_0401 CDS_414551-413478 57.5 4.1e-17 1
CP000688_0624 CDS_619504-618359 56.6 7.3e-17 1
CP000688_0838 CDS_837148-838239 34.5 2.3e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000688_0934 1/1 1023 1087 .. 1 70 [] 67.9 3.3e-20
CP000688_0401 1/1 147 214 .. 1 70 [] 57.5 4.1e-17
CP000688_0624 1/1 171 238 .. 1 70 [] 56.6 7.3e-17
CP000688_0838 1/1 159 226 .. 1 70 [] 34.5 2.3e-10

Alignments of top-scoring domains:
CP000688_0934: domain 1 of 1, from 1023 to 1087: score 67.9, E = 3.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHD vgQsL+++kl+l+ a+ d+ p++ ++ l+e+
CP000688_0 1023 ERATIARELHDQVGQSLTVLKLMLDKAK-----DSLPDRSEKLLAEA 1064

relarealaevRrllgdLRpaal<-*
+ l++e ++ vR++ dLRp l
CP000688_0 1065 QPLVSELISSVRNMSLDLRPRML 1087

CP000688_0401: domain 1 of 1, from 147 to 214: score 57.5, E = 4.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+RELHD+v+ L +++ +++ + ++ ++d + + +ld++
CP000688_0 147 ERKRISRELHDEVAPLLLLLMQKIDNLSKQS--ERDIADCKPQLDAL 191

relarealaevRrllgdLRpaal<-*
r+ ++eal+ +Rr+++dLRp +l
CP000688_0 192 RTQSEEALESLRRIAQDLRPRIL 214

CP000688_0624: domain 1 of 1, from 171 to 238: score 56.6, E = 7.3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ER+RIA+ELHD +Q L +i+ +++ +k+p ++ ++l
CP000688_0 171 ERRRIAQELHDDTAQDLIVISRAIDRFV-----TKNPNlgeDNLAEL 212

deirelarealaevRrllgdLRpaal<-*
+e++ +++++l+evRr ++dLRp++l
CP000688_0 213 EEMQNHINRTLSEVRRFAQDLRPSVL 238

CP000688_0838: domain 1 of 1, from 159 to 226: score 34.5, E = 2.3e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +A+E+HD +gQ+L++ ++ ++l+ ++ + ++e+ + + +
CP000688_0 159 ERKALAQEIHDQLGQALTGFNIDVSLIIKRS--KNLDPEIYKSAMCL 203

relarealaevRrllgdLRpaal<-*
e ++ ++++v r++++LR ++l
CP000688_0 204 SEKIQLTIQDVKRIATELRSQIL 226


Histogram of all scores:
score obs exp (one = represents 5 sequences)
----- --- ---
-14 15 0|===
-13 43 0|=========
-12 61 15|==*==========
-11 95 125|=================== *
-10 259 291|==================================================== *
-9 285 331|========================================================= *
-8 212 255|=========================================== *
-7 148 160|============================== *
-6 93 90|=================*=
-5 55 48|=========*=
-4 38 25|====*===
-3 25 13|==*==
-2 15 6|=*=
-1 6 3|*=
0 5 1|*
1 4 0|=
2 2 0|=
3 3 0|=
4 0 0|
> 5 7 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 190.4238
P(chi-square) = 1.596e-35

Total sequences searched: 1371

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: