Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for Geobacter uraniireducens Rf4  

Data for CP000698  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000698.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000698_1705 CDS_2007829-2010723 148.4 5.4e-42 1
CP000698_2088 CDS_2476826-2475108 147.1 1.2e-41 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000698_1705 1/1 765 851 .. 1 94 [] 148.4 5.4e-42
CP000698_2088 1/1 373 457 .. 1 94 [] 147.1 1.2e-41

Alignments of top-scoring domains:
CP000698_1705: domain 1 of 1, from 765 to 851: score 148.4, E = 5.4e-42
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISSLL+LQ+r + d+ + +++sqnRV+S
CP000698_1 765 EIHHRVKNNLQVISSLLNLQSRHIHDQRD-----VDMFMDSQNRVKS 806

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE LY++++l ++df+ Y++kL +nLf+syg + ++L+ l
CP000698_1 807 MALIHENLYQTKNLARIDFAGYIRKLSANLFRSYGININAVNLN--L 851

CP000698_2088: domain 1 of 1, from 373 to 457: score 147.1, E = 1.2e-41
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISS+L LQ+ +++d+e+ l a++Esq+RV +
CP000698_2 373 EIHHRVKNNLQVISSMLHLQSARATDKEI-----LMAFKESQSRVDT 414

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s+dl + ++ Y+ L+ nL s+g ++ i+
CP000698_2 415 MALIHEKLYQSKDLTVIPMAGYIGDLITNLYISFGINDEQIK----A 457


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-15 2 0|=
-14 9 0|=
-13 40 27|=*=
-12 211 286|============ *
-11 1048 796|============================================*==============
-10 924 1031|==================================================== *
-9 733 870|========================================= *
-8 583 584|================================*
-7 307 346|================== *
-6 273 193|==========*=====
-5 97 104|=====*
-4 53 55|===*
-3 34 28|=*
-2 19 15|*=
-1 14 7|*
0 3 4|*
1 0 2|*
2 4 1|*
3 0 0|
> 4 3 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 182.5572
P(chi-square) = 1.274e-32

Total sequences searched: 4357

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: