Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Sphingomonas wittichii RW1  

Data for CP000700  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000700.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000700_0155 CDS_166805-165126 117.8 4e-41 1
CP000700_0105 CDS_110858-109320 97.6 3.1e-34 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000700_0155 1/1 227 308 .. 1 85 [] 117.8 4e-41
CP000700_0105 1/1 321 402 .. 1 85 [] 97.6 3.1e-34

Alignments of top-scoring domains:
CP000700_0155: domain 1 of 1, from 227 to 308: score 117.8, E = 4e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKN LA+VQ+i +QTlRn +++efve+FsgR+q+++r+H++
CP000700_0 227 ELSHRVKNMLATVQAISTQTLRNCSDPAEFVESFSGRIQSMARVHSQ 273

VpLtrseWagAdLreLle..aeLaPyggedaeRitlsGPd<-*
L+ ++W g +Lr+++e+++ L+P + +++i sGPd
CP000700_0 274 --LSTTDWKGTELRAVVEegMKLGPVD---EPQIAASGPD 308

CP000700_0105: domain 1 of 1, from 321 to 402: score 97.6, E = 3.1e-34
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLAvV +i++Q+lR+a+s++e+ +a+ +RLq L++a L
CP000700_0 321 ELQHRVKNTLAVVNAIVHQSLRSAPSMEEASTAIGQRLQTLGAAYEL 367

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W A +++++e + a +g+ + i++ GPd
CP000700_0 368 --LTRTDWTVAPIGAVAEGTTALHGAR-TGAIRIAGPD 402


Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-14 1 0|=
-13 4 0|====
-12 35 0|===================================
-11 23 2|=*=====================
-10 43 29|============================*==============
-9 58 72|==========================================================*
-8 45 75|============================================= *
-7 27 50|=========================== *
-6 12 27|============ *
-5 15 13|============*==
-4 10 6|=====*====
-3 2 3|==*
-2 3 1|*==
-1 0 0|
0 2 0|==
1 1 0|=
> 2 4 -|====


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 43.8612
P(chi-square) = 7.876e-08

Total sequences searched: 285

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: