Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Brucella ovis ATCC 25840  

Data for CP000708  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000708.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000708_0329 CDS_372135-373514 69.9 1.2e-20 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000708_0329 1/1 250 317 .. 1 70 [] 69.9 1.2e-20

Alignments of top-scoring domains:
CP000708_0329: domain 1 of 1, from 250 to 317: score 69.9, E = 1.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+++Q+L +++ ++la r++ ++ + a +a++ +
CP000708_0 250 ERARLARELHDGISQNLVGVRYAIDLASRQV--RTGSGGAPQAIEKA 294

relarealaevRrllgdLRpaal<-*
++++ a++evRrl +dL p +l
CP000708_0 295 SDALNGAIKEVRRLSHDLCPRIL 317


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 14 0|===
-13 45 0|========
-12 68 21|===*========
-11 90 176|=============== *
-10 280 410|=============================================== *
-9 321 466|====================================================== *
-8 287 359|================================================ *
-7 283 225|=====================================*==========
-6 175 127|=====================*========
-5 155 68|===========*==============
-4 81 35|=====*========
-3 50 18|==*======
-2 29 9|=*===
-1 29 4|*====
0 6 2|*
1 6 1|*
2 3 0|=
3 5 0|=
4 0 0|
5 0 0|
> 6 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 536.9690
P(chi-square) = 0

Total sequences searched: 1930

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: