hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000708.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000708_1463 CDS_1612936-1612001 146.9 3.3e-50 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000708_1463 1/1 118 200 .. 1 85 [] 146.9 3.3e-50
Alignments of top-scoring domains:
CP000708_1463: domain 1 of 1, from 118 to 200: score 146.9, E = 3.3e-50
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN+LA+VQSia+QT+R+++s+d+f+ +F+gR+q+Ls ++dL
CP000708_1 118 EVSHRSKNLLAIVQSIATQTARFTDSIDDFLVKFRGRIQSLSYSQDL 164
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA + +L++++++ y + d+eR+t++G++
CP000708_1 165 --VTDSNWRGALFLDLVRSQVEKYIDIDDERLTIEGDN 200
Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-15 1 0|=
-14 17 0|===
-13 52 0|=========
-12 242 0|=========================================
-11 207 15|==*================================
-10 290 199|=================================*===============
-9 287 493|================================================ *
-8 344 512|==========================================================*
-7 208 344|=================================== *
-6 101 188|================= *
-5 76 93|============= *
-4 50 44|=======*=
-3 26 20|===*=
-2 12 9|=*
-1 9 4|*=
0 2 1|*
1 1 0|=
2 1 0|=
3 1 0|=
4 0 0|
> 5 3 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2602.2229
P(chi-square) = 0
Total sequences searched: 1930
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K