hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000712.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000712_2356 CDS_2733837-2731294 115.5 4.6e-39 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000712_2356 1/1 520 600 .. 1 85 [] 115.5 4.6e-39
Alignments of top-scoring domains:
CP000712_2356: domain 1 of 1, from 520 to 600: score 115.5, E = 4.6e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+L+++ +++++ +++l+++v+++ gR+qALs aHd+
CP000712_2 520 ELNHRVKNILSLIGALVAHPTPESQTLQDYVATLKGRIQALSLAHDQ 566
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++r + +g++L++LleaeL+Py+++ a+ i+l+GP+
CP000712_2 567 --VVRGD-GGGRLAKLLEAELSPYRTA-ADVIELQGPN 600
Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-16 2 0|=
-15 2 0|=
-14 15 0|=
-13 73 0|=====
-12 373 0|======================
-11 523 42|==*============================
-10 838 543|===============================*==================
-9 914 1344|====================================================== *
-8 986 1395|==========================================================*
-7 614 937|===================================== *
-6 373 511|====================== *
-5 235 253|==============*
-4 132 120|=======*
-3 93 55|===*==
-2 42 25|=*=
-1 20 11|*=
0 9 5|*
1 1 2|*
2 3 1|*
3 0 0|
> 4 4 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 5982.9282
P(chi-square) = 0
Total sequences searched: 5252
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K