Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Sinorhizobium medicae WSM419  

Data for CP000738  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000738.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000738_2316 CDS_2421807-2420305 143.5 8.6e-49 1
CP000738_3402 CDS_3651152-3652870 120.9 4.4e-41 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000738_2316 1/1 314 396 .. 1 85 [] 143.5 8.6e-49
CP000738_3402 1/1 376 458 .. 1 85 [] 120.9 4.4e-41

Alignments of top-scoring domains:
CP000738_2316: domain 1 of 1, from 314 to 396: score 143.5, E = 8.6e-49
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+ QS+arQTlR++ +++ef++aF+gRLqA s+aH+L
CP000738_2 314 ELNHRVKNTLAMLQSLARQTLRQTSDPAEFMTAFAGRLQAISEAHGL 360

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++ eW+ +L+eL++ +L Py ++++++i+l+ ++
CP000738_2 361 --LSDYEWGTIHLSELISKQLLPYVSDYSQQIELHKDE 396

CP000738_3402: domain 1 of 1, from 376 to 458: score 120.9, E = 4.4e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HR KN+L+v+QS+ +Q++++a+++ +fveaF+ RL+ L+r+ dL
CP000738_3 376 EVAHRAKNQLTVIQSMLAQSANSAEDPSDFVEAFRKRLAGLARSTDL 422

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++ + g+d++eL++ +L+P++++ ++R++lsGP
CP000738_3 423 --MVANAANGVDFSELVRNQLQPFMPAESDRVVLSGPV 458


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-16 1 0|=
-15 0 0|
-14 8 0|=
-13 38 0|====
-12 281 0|==========================
-11 389 28|==*=================================
-10 544 364|=================================*================
-9 643 903|==========================================================*
-8 636 937|==========================================================*
-7 405 629|===================================== *
-6 244 343|======================= *
-5 144 170|============== *
-4 88 80|=======*
-3 42 37|===*
-2 26 17|=*=
-1 19 7|*=
0 8 3|*
1 8 1|*
2 1 0|=
> 3 4 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4892.2881
P(chi-square) = 0

Total sequences searched: 3529

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: