Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Sinorhizobium medicae WSM419  

Data for CP000739  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000739.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000739_1325 CDS_1442210-1444933 127.5 1.1e-43 1
CP000739_0694 CDS_767954-771037 109.9 1e-37 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000739_1325 1/1 717 799 .. 1 85 [] 127.5 1.1e-43
CP000739_0694 1/1 846 925 .. 1 85 [] 109.9 1e-37

Alignments of top-scoring domains:
CP000739_1325: domain 1 of 1, from 717 to 799: score 127.5, E = 1.1e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+V SiarQT+ ++++ ++++F++R++AL+++H
CP000739_1 717 ELSHRVKNTLAIVGSIARQTFSTSPDARTAHRSFDARIRALAQTHTR 763

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +++W+g++L +l eLaPy +++++ + l+GP+
CP000739_1 764 --LAEASWSGVSLQTVLYDELAPYQDDGRTNVKLQGPT 799

CP000739_0694: domain 1 of 1, from 846 to 925: score 109.9, E = 1e-37
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN LAvV Sia+++ ++a+s++ef++a++gRLqA++ra +L
CP000739_0 846 ELNHRVKNMLAVVISIANHSMQTARSPNEFNQALIGRLQAMGRAYGL 892

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+++W A L+++e++++g +R+++ GPd
CP000739_0 893 --LTETHWTAAPVDHLIRQEIEAFG---TGRFEVNGPD 925


Histogram of all scores:
score obs exp (one = represents 5 sequences)
----- --- ---
-14 2 0|=
-13 14 0|===
-12 120 0|========================
-11 123 11|==*======================
-10 234 149|=============================*=================
-9 245 368|================================================= *
-8 268 382|====================================================== *
-7 179 257|==================================== *
-6 101 140|===================== *
-5 56 69|============ *
-4 49 32|======*===
-3 18 15|==*=
-2 15 7|=*=
-1 7 3|*=
0 2 1|*
1 3 0|=
2 2 0|=
> 3 3 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 1229.7285
P(chi-square) = 0

Total sequences searched: 1441

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: