Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Sinorhizobium medicae WSM419  

Data for CP000740  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000740.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000740_0652 CDS_747465-750947 158.7 1.9e-54 1
CP000740_0637 CDS_725201-724158 128.5 3.6e-44 1
CP000740_0624 CDS_710130-708934 112.4 1.1e-38 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000740_0652 1/1 969 1051 .. 1 85 [] 158.7 1.9e-54
CP000740_0637 1/1 153 235 .. 1 85 [] 128.5 3.6e-44
CP000740_0624 1/1 203 292 .. 1 85 [] 112.4 1.1e-38

Alignments of top-scoring domains:
CP000740_0652: domain 1 of 1, from 969 to 1051: score 158.7, E = 1.9e-54
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLAvVQS+arQTlR+++s+++fve+F+gRL+AL++aH L
CP000740_0 969 ELSHRVKNTLAVVQSLARQTLRTTRSSEDFVERFEGRLAALASAHKL 1015

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++seW+gA+L eL++++L++y++ d++R++++G++
CP000740_0 1016 --LVDSEWSGAELNELARRQLDAYAASDRRRLQIEGEP 1051

CP000740_0637: domain 1 of 1, from 153 to 235: score 128.5, E = 3.6e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA ++Si+++T+R+a sldef+++F+gRL+AL+++H+
CP000740_0 153 ELNHRVKNILASISSIFQMTRRRAVSLDEFADDFAGRLAALANVHSA 199

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+++++++ ++L+ ++e +++Py+ +d +R++++GP+
CP000740_0 200 --VFQADGEAVELSSVVELTFSPYRVKDTDRLVFTGPT 235

CP000740_0624: domain 1 of 1, from 203 to 292: score 112.4, E = 1.1e-38
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR KN++++V +++r ++R+++s+d++v +sgRL+AL++aH+L
CP000740_0 203 EMSHRLKNLFTIVDGMVRISARSTNSKDDLVSLLSGRLHALAAAHSL 249

V.p.LtrseWagAdLreLleaeLaPygged...aeRitlsGPd<-*
V+p++++ ++a L++L+++ ++P+ +++ ++ R+ l+GP+
CP000740_0 250 VkPsFSDVQGAASNLADLISIVIEPHKPAAifgRSRFSLEGPA 292


Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-14 6 0|==
-13 16 0|====
-12 71 0|==================
-11 120 8|=*============================
-10 176 113|============================*===============
-9 198 280|================================================== *
-8 189 290|================================================ *
-7 136 195|================================== *
-6 73 106|=================== *
-5 45 52|============*
-4 34 25|======*==
-3 11 11|==*
-2 7 5|=*
-1 5 2|*=
> 0 7 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 1507.6184
P(chi-square) = 0

Total sequences searched: 1094

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: