Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Sinorhizobium medicae WSM419  

Data for CP000741  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000741.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000741_0010 CDS_10486-8597 103.0 2.3e-36 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000741_0010 1/1 534 600 .. 1 69 [. 103.0 2.3e-36

Alignments of top-scoring domains:
CP000741_0010: domain 1 of 1, from 534 to 600: score 103.0, E = 2.3e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN LAvV Sia++Tl++a+s+++f++a+sgRL+A++ra ++
CP000741_0 534 ELNHRVKNMLAVVISIANHTLKGAPSPKDFNAALSGRLHAMARAYNV 580

VpLtrseWagAdLreLleaeLa<-*
Lt s+W A + +L+++eL+
CP000741_0 581 --LTNSNWTAAPIEDLVRQELG 600


Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-13 3 0|===
-12 16 0|================
-11 19 1|*==================
-10 21 15|==============*======
-9 26 38|========================== *
-8 26 39|========================== *
-7 18 26|================== *
-6 5 14|===== *
-5 3 7|=== *
-4 5 3|==*==
-3 1 1|*
-2 2 0|==
-1 0 0|
0 2 0|==
1 0 0|
> 2 2 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 19.5737
P(chi-square) = 0.0006061

Total sequences searched: 149

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: