Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Pseudomonas aeruginosa PA7  

Data for CP000744  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000744.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000744_1219 CDS_1238120-1236252 76.2 5.7e-22 1
CP000744_0743 CDS_747746-750145 68.1 1.4e-19 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000744_1219 1/1 411 481 .. 1 70 [] 76.2 5.7e-22
CP000744_0743 1/1 597 664 .. 1 70 [] 68.1 1.4e-19

Alignments of top-scoring domains:
CP000744_1219: domain 1 of 1, from 411 to 481: score 76.2, E = 5.7e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER IARELHDs++QsLs +k+q++++ +ll +++++ ++++++l+
CP000744_1 411 ERGTIARELHDSLAQSLSYLKIQVSRLGTLL--KREAPaqKIEDTLE 455

eirelarealaevRrllgdLR.paal<-*
e+re ++ a++++R+ll+++R ++
CP000744_1 456 ELREGLNGAYRQLRELLTTFRlSLDE 481

CP000744_0743: domain 1 of 1, from 597 to 664: score 68.1, E = 1.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIARE HD++gQ L+++kl +++++ ++ +++ + +re+l ++
CP000744_0 597 EKARIAREVHDELGQVLTVLKLETSMCELAY--ADAEDGLRERLGNM 641

relarealaevRrllgdLRpaal<-*
++l+ + + vR+++++LRp++l
CP000744_0 642 KKLIAQLFQLVRDVATALRPPIL 664


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 29 0|==
-13 95 0|======
-12 157 70|====*=====
-11 235 576|============== *
-10 659 1336|======================================= *
-9 995 1518|==========================================================*
-8 862 1169|=================================================== *
-7 825 735|===========================================*=====
-6 705 416|========================*=================
-5 677 223|=============*==========================
-4 393 116|======*=================
-3 215 59|===*=========
-2 181 30|=*=========
-1 90 15|*=====
0 55 7|*===
1 45 4|*==
2 28 2|*=
3 12 1|*
4 8 0|=
5 6 0|=
6 5 0|=
7 1 0|=
8 2 0|=
9 1 0|=
10 0 0|
11 1 0|=
12 1 0|=
13 0 0|
> 14 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 4476.7183
P(chi-square) = 0

Total sequences searched: 6286

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: