Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for   

Data for CP000747  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000747.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000747_0300 CDS_295605-293953 127.7 3.4e-36 1
CP000747_0501 CDS_528596-526323 91.9 5e-26 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000747_0300 1/1 340 426 .. 1 94 [] 127.7 3.4e-36
CP000747_0501 1/1 566 650 .. 1 94 [] 91.9 5e-26

Alignments of top-scoring domains:
CP000747_0300: domain 1 of 1, from 340 to 426: score 127.7, E = 3.4e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISSLL++Q r+ +d+++ + a+ ++++R+ +
CP000747_0 340 EIHHRVKNNLQVISSLLNMQQRSLSDPAA-----RSAMSDTRQRITA 381

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
Ali++ LY++ dl++vd++++le+Lt++L + v + ++ + +
CP000747_0 382 LALIYRALYQGPDLKRVDLRPFLEELTAQLVSGDLVHGPAVRTE--M 426

CP000747_0501: domain 1 of 1, from 566 to 650: score 91.9, E = 5e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HR+KNNLQ+I SL+ LQ r+++de++ + aLr q+R+++
CP000747_0 566 ETDHRIKNNLQLIGSLVLLQGRRTRDEAA-----RQALRAVQQRIAA 607

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++l H++ + ++ ++v++s l++L+++L +g++++ i +
CP000747_0 608 VSLAHRHIRREGGAERVELSGLLRELASDLAAGAGREDIEIA----M 650


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-15 3 0|=
-14 18 0|==
-13 44 22|=*=
-12 220 231|=============*
-11 964 645|=====================================*===================
-10 822 835|=================================================*
-9 546 705|================================= *
-8 433 473|========================== *
-7 202 281|============ *
-6 141 156|=========*
-5 55 84|====*
-4 36 44|==*
-3 25 23|=*
-2 6 12|*
-1 2 6|*
0 3 3|*
> 1 9 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 258.1764
P(chi-square) = 0

Total sequences searched: 3529

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: