Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Phenylobacterium zucineum HLK1  

Data for CP000747  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000747.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000747_0598 CDS_639568-638069 156.8 2.6e-53 1
CP000747_1031 CDS_1150835-1148616 146.5 8.5e-50 1
CP000747_2290 CDS_2600818-2599157 141.2 5.3e-48 1
CP000747_3076 CDS_3507278-3508759 121.7 2.3e-41 1
CP000747_0311 CDS_302733-304172 105.5 7.7e-36 1
CP000747_3048 CDS_3481536-3480151 77.1 3.7e-26 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000747_0598 1/1 317 396 .. 1 85 [] 156.8 2.6e-53
CP000747_1031 1/1 551 633 .. 1 85 [] 146.5 8.5e-50
CP000747_2290 1/1 362 441 .. 1 85 [] 141.2 5.3e-48
CP000747_3076 1/1 309 390 .. 1 85 [] 121.7 2.3e-41
CP000747_0311 1/1 152 231 .. 1 85 [] 105.5 7.7e-36
CP000747_3048 1/1 276 352 .. 1 82 [. 77.1 3.7e-26

Alignments of top-scoring domains:
CP000747_0598: domain 1 of 1, from 317 to 396: score 156.8, E = 2.6e-53
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQSia QTlR+a+++++f+eaF++RL+ALs++HdL
CP000747_0 317 ELNHRVKNTLATVQSIASQTLRTAPDPAAFREAFEARLMALSATHDL 363

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++W++A Lr++l +e++P+g aeR lsGPd
CP000747_0 364 --LTATSWRSAQLRDVLLSEVQPHG---AERYSLSGPD 396

CP000747_1031: domain 1 of 1, from 551 to 633: score 146.5, E = 8.5e-50
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQS+a+QTlR e++++F++RL ALs+aH++
CP000747_1 551 ELNHRVKNTLATVQSLAHQTLREGMVTREARDRFTDRLLALSAAHNV 597

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W++A+L+e+++++++Py++++a+R+ l+GP+
CP000747_1 598 --LTRENWESAELSEIAREAVRPYNDPQAPRVLLEGPT 633

CP000747_2290: domain 1 of 1, from 362 to 441: score 141.2, E = 5.3e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQSia+Q+lR +s +e +e+F++RL ALs +H+L
CP000747_2 362 ELNHRVKNTLATVQSIAAQSLREGRSAAETRETFEARLLALSHTHNL 408

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W+gAdLre++++eL+P+g ++R++++G +
CP000747_2 409 --LTRAHWRGADLREIVRQELSPHG---EGRVRIDGGP 441

CP000747_3076: domain 1 of 1, from 309 to 390: score 121.7, E = 2.3e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLAvVQS+arQT+R+a++l+ + +aF++RL ALsraH+L
CP000747_3 309 ELNHRVKNTLAVVQSLARQTFRGATDLARASDAFEARLGALSRAHNL 355

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++W+ AdLr++++ +++ ++ ++R ++G +
CP000747_3 356 --LTHASWEAADLRDVVRDQVSQV-ADVERRAIVEGLS 390

CP000747_0311: domain 1 of 1, from 152 to 231: score 105.5, E = 7.7e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKN LA+VQ++a QT ++++sl++f+++F gRL A+++a L
CP000747_0 152 ELDHRVKNVLATVQALAIQTGKRTTSLPAFLQTFGGRLKAMASANEL 198

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++W+gA L++ +L++ + +++ +GP+
CP000747_0 199 --LTAARWRGAAVDHLVAGALSALA---PGQTSAEGPE 231

CP000747_3048: domain 1 of 1, from 276 to 352: score 77.1, E = 3.7e-26
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR KN + v ++i++QT+R+ ++ ef + + +RL+A++++HdL
CP000747_3 276 ELAHRAKNGIQVMMAIVAQTARSVSTVHEFETVLNARLRAMAESHDL 322

VpLtrseWagAdLreLleaeLaPyggedaeRitls<-*
+t s ++++ L+++++ +L P++ R++++
CP000747_3 323 --VTASGGRPVALADVVAKTLTPFD---TARFEVD 352


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 2 0|=
-13 23 0|==
-12 142 0|============
-11 234 28|==*=================
-10 457 364|==============================*========
-9 626 903|===================================================== *
-8 690 937|==========================================================*
-7 485 629|========================================= *
-6 338 343|============================*
-5 227 170|==============*====
-4 116 80|======*===
-3 92 37|===*====
-2 39 17|=*==
-1 25 7|*==
0 12 3|*
1 7 1|*
2 1 0|=
3 1 0|=
4 2 0|=
5 1 0|=
6 0 0|
7 1 0|=
8 1 0|=
9 0 0|
> 10 7 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 1844.5299
P(chi-square) = 0

Total sequences searched: 3529

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: