Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

3 accessions found for Kineococcus radiotolerans SRS30216  

Data for CP000750  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000750.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000750_1193 CDS_1269122-1270438 97.2 2.6e-28 1
CP000750_1347 CDS_1444384-1443200 90.3 2.8e-26 1
CP000750_4189 CDS_4417683-4416535 86.6 3.5e-25 1
CP000750_4233 CDS_4457988-4459397 85.0 1e-24 2
CP000750_2521 CDS_2619917-2618727 82.6 5e-24 1
CP000750_1974 CDS_2070836-2072248 82.2 6.8e-24 1
CP000750_2581 CDS_2683287-2682127 71.3 1.1e-20 1
CP000750_3887 CDS_4103464-4102169 71.2 1.2e-20 1
CP000750_2639 CDS_2731906-2730545 68.4 7.7e-20 1
CP000750_0502 CDS_533188-534393 68.2 9.4e-20 1
CP000750_1987 CDS_2085446-2086714 67.3 1.7e-19 2
CP000750_1992 CDS_2092197-2090686 66.6 2.7e-19 1
CP000750_2502 CDS_2589120-2587945 64.4 1.2e-18 1
CP000750_3992 CDS_4213705-4212470 58.9 5e-17 1
CP000750_3302 CDS_3429542-3430738 52.4 4e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000750_1193 1/1 232 299 .. 1 70 [] 97.2 2.6e-28
CP000750_1347 1/1 192 259 .. 1 70 [] 90.3 2.8e-26
CP000750_4189 1/1 181 248 .. 1 70 [] 86.6 3.5e-25
CP000750_4233 2/2 227 295 .. 1 70 [] 84.7 1.3e-24
CP000750_2521 1/1 189 256 .. 1 70 [] 82.6 5e-24
CP000750_1974 1/1 255 322 .. 1 70 [] 82.2 6.8e-24
CP000750_2581 1/1 183 249 .. 1 70 [] 71.3 1.1e-20
CP000750_3887 1/1 234 302 .. 1 70 [] 71.2 1.2e-20
CP000750_2639 1/1 235 303 .. 1 70 [] 68.4 7.7e-20
CP000750_0502 1/1 192 260 .. 1 70 [] 68.2 9.4e-20
CP000750_1992 1/1 268 335 .. 1 70 [] 66.6 2.7e-19
CP000750_1987 2/2 232 299 .. 1 70 [] 65.3 6.3e-19
CP000750_2502 1/1 165 232 .. 1 70 [] 64.4 1.2e-18
CP000750_3992 1/1 221 288 .. 1 70 [] 58.9 5e-17
CP000750_3302 1/1 208 275 .. 1 70 [] 52.4 4e-15

Alignments of top-scoring domains:
CP000750_1193: domain 1 of 1, from 232 to 299: score 97.2, E = 2.6e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD+v++s+s+i +q+ +ar+++ ++ p++a++++d i
CP000750_1 232 ERNRIARDLHDVVAHSMSVIGVQATTARYRI--PDLPPAAQAEFDDI 276

relarealaevRrllgdLRpaal<-*
++ ar+alae+R llg+LR ++
CP000750_1 277 AAQARTALAEMRTLLGVLRSRGD 299

CP000750_1347: domain 1 of 1, from 192 to 259: score 90.3, E = 2.8e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v++sLs+i+ q+++ r+++ +dp+ a + l++i
CP000750_1 192 ERQRIAREMHDVVAHSLSVIIAQADGGRYAA--GADPAVAVRVLETI 236

relarealaevRrllgdLRpaal<-*
+++r+al+++R+llg+LR +
CP000750_1 237 SGTGRQALSDMRNLLGVLRQGPG 259

CP000750_4189: domain 1 of 1, from 181 to 248: score 86.6, E = 3.5e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v+++ +a+ +q+e+ r l+ ++ pe++++ l i
CP000750_4 181 ERARIARELHDVVSHHVTAMVVQAEAMRFLV--ERQPERVAAGLGVI 225

relarealaevRrllgdLRpaal<-*
e++r a++++R+llg+L+ a++
CP000750_4 226 GETGRSAMTDLRDLLGALHGAGD 248

CP000750_4233: domain 2 of 2, from 227 to 295: score 84.7, E = 1.3e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++++++s+++l++++++ + d pe++++++++i
CP000750_4 227 ERTRIAREMHDVLAHRISLVALHAGGLEVRP--DVGPEQVEATAATI 271

relarealaevRrllgdLR.paal<-*
re+ar al+++Rr+lg+LR p++
CP000750_4 272 RETARSALEDLRRVLGVLRaPGTG 295

CP000750_2521: domain 1 of 1, from 189 to 256: score 82.6, E = 5e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA++LHDsv++++s+i+lq+++a+r+l + p+ a++al++i
CP000750_2 189 ERLRIAQDLHDSVAHTISGISLQAGAAERAL--TQRPQDAAAALAAI 233

relarealaevRrllgdLRpaal<-*
r+++re+l e+ ++lg+LR+++
CP000750_2 234 RTASRESLVELQQILGVLRDQDP 256

CP000750_1974: domain 1 of 1, from 255 to 322: score 82.2, E = 6.8e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD v++s s++ +++a+ +l d++pe+ r+al+e+
CP000750_1 255 ERARIAREMHDIVAHSVSVMVALSDGAASAL--DRAPEASRQALAEL 299

relarealaevRrllgdLRpaal<-*
+++real+++R +lg LRp +
CP000750_1 300 SRTGREALEDMRSVLGSLRPVEA 322

CP000750_2581: domain 1 of 1, from 183 to 249: score 71.3, E = 1.1e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA ELHD+v ++ +a+ +q+e+a++l+ ++pe++ ++l+e+
CP000750_2 183 ERTRIAGELHDVVTHHVTAMVVQTEAAHYLT---AAPEKLTATLTEV 226

relarealaevRrllgdLRpaal<-*
+e++r+a++++R+ll L p
CP000750_2 227 AETGRRAISDLRHLLDLLDPEHG 249

CP000750_3887: domain 1 of 1, from 234 to 302: score 71.2, E = 1.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+RI R+LHD+ Q+L a++lql++arr+l ++dp+ + l++
CP000750_3 234 ERRRIERDLHDGPQQRLVAVALQLGMARRAL--ERDPQaDVSGFLQA 278

irelarealaevRrllgdLRpaal<-*
+++ area++++R +++++ p++l
CP000750_3 279 AQGNAREAITDMRSVARGIVPPVL 302

CP000750_2639: domain 1 of 1, from 235 to 303: score 68.4, E = 7.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHDsvg++ +++++ l+ a+ +l ++ +++ar+ l+++
CP000750_2 235 ERVRIARDLHDSVGHAVAVVSMRLGSAEVQL--PAGADAARADLAAA 279

relarealaevRrllgdLR.paal<-*
r+ ++e l+e+ ++l++LR +++
CP000750_2 280 RTGIQEVLREMQQILQVLRvEDGQ 303

CP000750_0502: domain 1 of 1, from 192 to 260: score 68.2, E = 9.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE+HD++++++s++++++++++ +l+ ++++e+ + +++i
CP000750_0 192 ERSRIAREMHDVLAHRISLVSMHAGALEVRLE-GSADPEVVASAATI 237

relarealaevRrllgdLRpaal<-*
r+ a+ al+++R++lg+LR ++
CP000750_0 238 RRSAHAALEDLRDILGVLRQDDA 260

CP000750_1992: domain 1 of 1, from 268 to 335: score 66.6, E = 2.7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD v++s s+++ ++a +l d +pe+ r+al+ +
CP000750_1 268 ERARIAREMHDIVAHSVSVMIALGHGASVAL--DHAPERSRAALEDL 312

relarealaevRrllgdLRpaal<-*
+++r al ++Rr+lg+L++++
CP000750_1 313 VATGRSALGDMRRILGVLHEDGT 335

CP000750_1987: domain 2 of 2, from 232 to 299: score 65.3, E = 6.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD++ ++ a+ ++l++a+r+l ++dp++a ++++
CP000750_1 232 ELRRIERDLHDGIQNRMVAVVVHLGMAERAL--RRDPAAALPIVQTA 276

relarealaevRrllgdLRpaal<-*
+++a++ala++R++++ + p++l
CP000750_1 277 HAAADQALADLRAVVRSIYPPVL 299

CP000750_2502: domain 1 of 1, from 165 to 232: score 64.4, E = 1.2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ ARELHD+v+++ +++ + +++ar ++ ++ +++++ +l++i
CP000750_2 165 EREEVARELHDVVAHHVTGMVVATQAARLVA--TRSDARLDPTLAAI 209

relarealaevRrllgdLRpaal<-*
++++ eala +Rrl+ +LR++ +
CP000750_2 210 EGAGAEALAAMRRLVEVLRTDPD 232

CP000750_3992: domain 1 of 1, from 221 to 288: score 58.9, E = 5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R LHD+ +L ++++ l++arr l ++dp+ a+e l+++
CP000750_3 221 ELRRIERSLHDGAQNRLVGVTVLLGAARRSL--TRDPATADELLERA 265

relarealaevRrllgdLRpaal<-*
+++a++alae+R++++++ p++l
CP000750_3 266 QTAAEQALAELRAVVRGILPPVL 288

CP000750_3302: domain 1 of 1, from 208 to 275: score 52.4, E = 4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E + I R LHD+ +L+ai+l+++lar++l ++dp+ a e ld +
CP000750_3 208 EVRAIERNLHDGTQARLTAIALHVDLARHRL--RADPGGAGELLDVA 252

relarealaevRrllgdLRpaal<-*
+++ rea++e+R ++++++p+al
CP000750_3 253 HTTTREAITELRTIIRGIHPPAL 275


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 2 0|=
-13 16 0|==
-12 59 50|====*
-11 109 410|========== *
-10 309 952|========================== *
-9 637 1081|====================================================== *
-8 622 833|==================================================== *
-7 664 524|===========================================*============
-6 554 296|========================*======================
-5 565 159|=============*==================================
-4 337 83|======*======================
-3 218 42|===*===============
-2 146 21|=*===========
-1 79 11|*======
0 62 5|*=====
1 29 2|*==
2 24 1|*=
3 15 0|==
4 7 0|=
5 3 0|=
6 3 0|=
7 2 0|=
8 0 0|
> 9 18 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 5368.7310
P(chi-square) = 0

Total sequences searched: 4480

Whole sequence top hits:
tophits_s report:
Total hits: 15
Satisfying E cutoff: 15
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 15
Satisfying E cutoff: 15
Total memory: 26K


Acknowledgements:

This research is funded by:

Developed by: