Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

6 accessions found for Ochrobactrum anthropi ATCC 49188  

Data for CP000758  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000758.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000758_0441 CDS_471163-472620 72.3 3.4e-21 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000758_0441 1/1 276 343 .. 1 70 [] 72.3 3.4e-21

Alignments of top-scoring domains:
CP000758_0441: domain 1 of 1, from 276 to 343: score 72.3, E = 3.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+++Q+L +++ ++la r++ + d + a a++ +
CP000758_0 276 ERARLARELHDGISQNLVGVRYAIDLASRQV--RMDSGGAPLAIEKA 320

relarealaevRrllgdLRpaal<-*
++++ a++evRrl +dLRp +l
CP000758_0 321 SDALNGAIKEVRRLSHDLRPRIL 343


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 6 0|=
-13 35 0|====
-12 70 30|===*====
-11 140 250|================ *
-10 417 580|=============================================== *
-9 510 659|========================================================= *
-8 438 508|================================================= *
-7 326 319|===================================*=
-6 274 180|===================*===========
-5 221 97|==========*==============
-4 120 50|=====*========
-3 63 26|==*====
-2 39 13|=*===
-1 36 6|*===
0 11 3|*=
1 12 1|*=
2 5 0|=
3 2 0|=
4 2 0|=
5 0 0|
6 2 0|=
> 7 2 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 719.2477
P(chi-square) = 0

Total sequences searched: 2731

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: