hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000758.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000758_1229 CDS_1315345-1314335 138.9 2.5e-47 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000758_1229 1/1 143 225 .. 1 85 [] 138.9 2.5e-47
Alignments of top-scoring domains:
CP000758_1229: domain 1 of 1, from 143 to 225: score 138.9, E = 2.5e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN+LA+VQSia QT+R+++s+d+f+ +F+gR+q+Ls ++dL
CP000758_1 143 EVSHRSKNLLAIVQSIASQTARFTDSIDDFLLKFRGRIQSLSYSQDL 189
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA +r+L+ ++++ y + +eR+ ++G++
CP000758_1 190 --VTDSNWRGALFRDLVHSQVEKYIDVSDERLSIDGDN 225
Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-16 1 0|=
-15 1 0|=
-14 5 0|=
-13 38 0|=====
-12 236 0|===========================
-11 335 22|==*===================================
-10 468 282|===============================*====================
-9 425 698|================================================ *
-8 497 725|======================================================== *
-7 286 487|================================ *
-6 170 266|=================== *
-5 120 131|==============*
-4 73 62|======*==
-3 35 29|===*
-2 18 13|=*
-1 7 6|*
0 8 2|*
1 1 1|*
2 3 0|=
3 1 0|=
4 0 0|
> 5 3 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4805.8643
P(chi-square) = 0
Total sequences searched: 2731
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K