Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

6 accessions found for Ochrobactrum anthropi ATCC 49188  

Data for CP000759  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000759.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000759_0895 CDS_1037618-1039093 134.6 4.4e-46 1
CP000759_1548 CDS_1738387-1737290 77.3 1.5e-26 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000759_0895 1/1 286 368 .. 1 85 [] 134.6 4.4e-46
CP000759_1548 1/1 171 250 .. 1 85 [] 77.3 1.5e-26

Alignments of top-scoring domains:
CP000759_0895: domain 1 of 1, from 286 to 368: score 134.6, E = 4.4e-46
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E +HR+KN++A+VQSia+QTlRna++++ ++e Fs RL+ALs+aHd+
CP000759_0 286 EISHRFKNSMAMVQSIANQTLRNATDPQTANELFSERLRALSQAHDM 332

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L r++W g ++++++e +LaP+++ ++Ri+ sGP+
CP000759_0 333 --LLREDWTGTTISQICETALAPFNSTFGHRIRTSGPE 368

CP000759_1548: domain 1 of 1, from 171 to 250: score 77.3, E = 1.5e-26
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR+KNt+++V +ia QT++ + +e +F+ RL AL++aHd+
CP000759_1 171 ELAHRIKNTFSIVAAIAGQTFN-NNADEEVINTFTRRLFALGNAHDV 216

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + ++Lr++++ + + a+R+++sGPd
CP000759_1 217 --LRLGKSSEGSLRQIVSGITNALAV--ADRVQISGPD 250


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-15 1 0|=
-14 2 0|=
-13 17 0|===
-12 123 0|=====================
-11 165 13|==*=========================
-10 304 175|=============================*=====================
-9 269 433|============================================= *
-8 310 449|==================================================== *
-7 206 302|=================================== *
-6 125 164|===================== *
-5 82 81|=============*
-4 42 38|======*
-3 18 17|==*
-2 11 8|=*
-1 6 3|*
0 3 1|*
1 4 0|=
2 2 0|=
3 0 0|
> 4 3 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 1893.7714
P(chi-square) = 0

Total sequences searched: 1693

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: