Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for Anaeromyxobacter sp. Fw109-5  

Data for CP000769  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000769.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000769_1792 CDS_2043391-2045313 66.9 2.2e-19 1
CP000769_3318 CDS_3921094-3922761 47.4 1.3e-13 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000769_1792 1/1 423 487 .. 1 70 [] 66.9 2.2e-19
CP000769_3318 1/1 361 429 .. 1 70 [] 47.4 1.3e-13

Alignments of top-scoring domains:
CP000769_1792: domain 1 of 1, from 423 to 487: score 66.9, E = 2.2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+ QsL++++++le+a+ d+ + +lde+
CP000769_1 423 ERKRIARELHDETTQSLAVLAMGLEAAQ-----DALRTGLTPRLDEV 464

relarealaevRrllgdLRpaal<-*
++ a ++l++v rl+ dLRp++l
CP000769_1 465 KAVALRTLEDVHRLILDLRPSVL 487

CP000769_3318: domain 1 of 1, from 361 to 429: score 47.4, E = 1.3e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHDsv Q +++l+l +ar++++ eea +++++
CP000769_3 361 ERRRIARDLHDSVIQPYLGLRLGLAAARKAFE-GGRTEEAGGHVARL 406

relarealaevRrllgdLRpaal<-*
e a+ ++ +R +++LR a+
CP000769_3 407 VEVADAEIQTLRGYVRELRAADG 429


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 2 0|=
-13 11 0|=
-12 39 49|====*
-11 91 409|======== *
-10 293 949|========================= *
-9 593 1078|================================================== *
-8 552 831|============================================== *
-7 592 522|===========================================*======
-6 513 295|========================*==================
-5 668 158|=============*==========================================
-4 379 82|======*=========================
-3 230 42|===*================
-2 170 21|=*=============
-1 123 11|*==========
0 61 5|*=====
1 50 2|*====
2 37 1|*===
3 20 0|==
4 15 0|==
5 8 0|=
6 4 0|=
7 3 0|=
8 4 0|=
9 1 0|=
10 1 0|=
11 1 0|=
12 0 0|
13 0 0|
14 1 0|=
> 15 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 7389.3569
P(chi-square) = 0

Total sequences searched: 4466

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: