hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000774.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000774_0358 CDS_382262-384070 98.0 2.8e-33 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000774_0358 1/1 256 337 .. 1 85 [] 98.0 2.8e-33
Alignments of top-scoring domains:
CP000774_0358: domain 1 of 1, from 256 to 337: score 98.0, E = 2.8e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA++Q+ia Q+l+ aas+ +fv++F gR AL+raH L
CP000774_0 256 ELNHRVKNTLATIQAIASQSLQKAASPSDFVTSFNGRVEALGRAHEL 302
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++ + +gAd + ++++++ ++e + R+ sGP
CP000774_0 303 --LVQGQMSGADVAGIVREQVVLGDTE-GARVSCSGPY 337
Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-15 1 0|=
-14 4 0|=
-13 42 0|====
-12 247 0|=====================
-11 327 29|==*=========================
-10 521 376|===============================*============
-9 635 930|===================================================== *
-8 690 966|==========================================================*
-7 460 649|======================================= *
-6 294 354|========================= *
-5 187 175|==============*=
-4 102 83|======*==
-3 64 38|===*==
-2 21 17|=*
-1 20 8|*=
0 9 3|*
1 7 1|*
2 2 0|=
> 3 3 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3307.8489
P(chi-square) = 0
Total sequences searched: 3636
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K