Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
19 projects found  

3 accessions found for Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'  

Data for CP000777  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000777.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000777_2921 CDS_3233687-3231882 103.2 3e-29 1
CP000777_1051 CDS_1166683-1167924 93.3 1.8e-26 1
CP000777_2629 CDS_2886768-2885830 73.9 6.1e-21 1
CP000777_2454 CDS_2692150-2693697 63.1 7.4e-18 1
CP000777_2313 CDS_2524082-2521926 57.7 2.5e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000777_2921 1/1 404 490 .. 1 94 [] 103.2 3e-29
CP000777_1051 1/1 214 299 .. 1 94 [] 93.3 1.8e-26
CP000777_2629 1/1 115 202 .. 1 94 [] 73.9 6.1e-21
CP000777_2454 1/1 317 400 .. 1 94 [] 63.1 7.4e-18
CP000777_2313 1/1 528 613 .. 1 94 [] 57.7 2.5e-16

Alignments of top-scoring domains:
CP000777_2921: domain 1 of 1, from 404 to 490: score 103.2, E = 3e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRVKN L++IS+LL+L++ k+++e + + + +q+R++S
CP000777_2 404 ELQHRVKNTLAIISGLLNLESFKVENELA-----KQSFLNAQSRIMS 445

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+ ++E LY+s dl++vd++ Y+e L+ +L + + + ++i+++ +
CP000777_2 446 MSKVYENLYQSADLESVDLRKYIEDLVYSLHDIFVLNPSKIRFD--V 490

CP000777_1051: domain 1 of 1, from 214 to 299: score 93.3, E = 1.8e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNL+vI+S L LQ +++ +e+ ++L+ s+ R+++
CP000777_1 214 EVHHRVKNNLAVIISFLQLQV-YSSPPET-----ADILEQSIVRIKA 254

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE+LY +++l+ + +Y++ L+en++ y+++++ i+L+ +
CP000777_1 255 IALVHEKLYSGKNLSGLSSVDYITSLVENIKLMYMRSDIQIELD--I 299

CP000777_2629: domain 1 of 1, from 115 to 202: score 73.9, E = 6.1e-21
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRV NNLQ+IS+L LQ ++ de+ L+ qnR+++
CP000777_2 115 EIHHRVNNNLQIISGLMALQIESENDEKL-----TTSLNLIQNRIKA 156

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H+ Y s +l v++ + ++ +++nL+ +y ++ i+++ +l
CP000777_2 157 IASVHKLIYGSPNLLFVNLNQIFNSILSNLKITYLKEHAEIEFR-EL 202

CP000777_2454: domain 1 of 1, from 317 to 400: score 63.1, E = 7.4e-18
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHR+KNN+ + LL LQa ++eev ++ L+E+ +R+++
CP000777_2 317 EVHHRIKNNMTILNNLLQLQASANESEEV-----RNSLKEATSRIKT 358

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l++++LY ++ + + eYl Lt+++++++ + L +
CP000777_2 359 MSLLYDKLYSGKINQELSLYEYLVPLTNEILSLFPYPVQ---LQ--M 400

CP000777_2313: domain 1 of 1, from 528 to 613: score 57.7, E = 2.5e-16
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNN+ LL LQa + e v + +L E+ +R++S
CP000777_2 528 EIHHRVKNNMSSLFTLLTLQAKSQNHEPV-----QTILYEAAGRIKS 569

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m ++++LY se +v + Y+ +++++ + + ++ + ++L+ +
CP000777_2 570 MIVLYDKLYHSETDNSVSIQNYFPSICSEIVSIFPKKVE-VNLS--I 613


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-15 1 0|=
-14 1 0|=
-13 20 20|=*
-12 104 215|======== *
-11 731 599|==============================================*==========
-10 632 775|================================================= *
-9 627 655|================================================= *
-8 431 439|=================================*
-7 235 260|===================*
-6 304 145|===========*============
-5 69 78|=====*
-4 41 41|===*
-3 36 21|=*=
-2 19 11|*=
-1 12 5|*
0 5 3|*
1 0 1|*
2 0 0|
3 1 0|=
4 1 0|=
5 0 0|
6 0 0|
> 7 7 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 311.8758
P(chi-square) = 0

Total sequences searched: 3277

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: