Crenarchaeota Euryarchaeota Nanoarchaeota
Other Archaea
Classification of phyla is from NCBI page
Search:
82 projects found  

1 accessions found for Candidatus Methanoregula boonei 6A8  

Data for CP000780  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000780.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000780_1490 CDS_1551522-1555283 155.7 2.5e-44 1
CP000780_1002 CDS_988640-987597 149.1 1.8e-42 1
CP000780_1804 CDS_1893299-1897471 145.1 2.5e-41 1
CP000780_1798 CDS_1885429-1883384 135.6 1.3e-38 1
CP000780_0930 CDS_919568-923101 128.3 1.6e-36 1
CP000780_1353 CDS_1385698-1383803 110.9 1.4e-31 1
CP000780_1354 CDS_1387272-1385698 101.3 7.3e-29 1
CP000780_2398 CDS_2476709-2478127 94.6 6e-27 1
CP000780_1510 CDS_1575779-1579396 93.7 1.1e-26 1
CP000780_1521 CDS_1596336-1600019 88.7 2.8e-25 1
CP000780_1481 CDS_1536372-1539146 71.0 3.1e-20 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000780_1490 1/1 1016 1102 .. 1 94 [] 155.7 2.5e-44
CP000780_1002 1/1 154 238 .. 1 94 [] 149.1 1.8e-42
CP000780_1804 1/1 1194 1282 .. 1 94 [] 145.1 2.5e-41
CP000780_1798 1/1 488 573 .. 1 94 [] 135.6 1.3e-38
CP000780_0930 1/1 976 1064 .. 1 94 [] 128.3 1.6e-36
CP000780_1353 1/1 432 515 .. 1 94 [] 110.9 1.4e-31
CP000780_1354 1/1 326 407 .. 1 94 [] 101.3 7.3e-29
CP000780_2398 1/1 257 339 .. 1 94 [] 94.6 6e-27
CP000780_1510 1/1 1001 1084 .. 1 94 [] 93.7 1.1e-26
CP000780_1521 1/1 1031 1115 .. 1 94 [] 88.7 2.8e-25
CP000780_1481 1/1 723 783 .. 1 66 [. 71.0 3.1e-20

Alignments of top-scoring domains:
CP000780_1490: domain 1 of 1, from 1016 to 1102: score 155.7, E = 2.5e-44
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLL+LQ rk++d+++ +e+L+++q+RVlS
CP000780_1 1016 EIHHRVKNNLQIISSLLNLQIRKIDDPKT-----IEVLKDCQSRVLS 1057

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LYk++d++++d++ Y+ L +L qsyg ++ ++++ l
CP000780_1 1058 MALVHEHLYKGKDFSRIDLKNYIHSLGMQLSQSYGNANEIVRFD--L 1102

CP000780_1002: domain 1 of 1, from 154 to 238: score 149.1, E = 1.8e-42
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvI SLL LQa + d+ + +aL +sq R++S
CP000780_1 154 EIHHRVKNNLQVIVSLLYLQAKATGDPTC-----AAALLDSQTRIKS 195

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE LY+s+d+++vd++ Yl++L++nL+ +yg + +gi+ +
CP000780_1 196 MALIHENLYQSGDFSSVDLDRYLRNLAGNLMVAYGTDPGGIR----V 238

CP000780_1804: domain 1 of 1, from 1194 to 1282: score 145.1, E = 2.5e-41
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+I+S+LrLQ r ++d+ +++L +s++RV+S
CP000780_1 1194 EIHHRVKNNLQIIISILRLQNRHITDPGM-----QAILLDSESRVRS 1235

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LY+s dl +d+++Yl+ Lt++Lf++y+v +++ +k+++
CP000780_1 1236 MALVHEKLYRSIDLAHIDIGDYLRDLTRYLFNTYSVNQGRVAFKVEI 1282

CP000780_1798: domain 1 of 1, from 488 to 573: score 135.6, E = 1.3e-38
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNN+QvIS+ L LQ+ +++d+e e L+E+q+RV+S
CP000780_1 488 EVHHRVKNNMQVISGFLQLQSNYISDPES-----AEKLNECQRRVRS 529

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LY+s+ l+ ++++eY++ L+++L ++y v++d +++++
CP000780_1 530 MALVHEKLYQSRHLGFINVAEYIKSLVSELQEAYVVQAD---IRFEV 573

CP000780_0930: domain 1 of 1, from 976 to 1064: score 128.3, E = 1.6e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+I+SL +LQ r ++++ + ++E+qnRV++
CP000780_0 976 EIHHRVKNNLQLIISLTNLQMRESSNPQL-----IQMMKETQNRVRA 1017

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+HE+LY+s+d+ ++++++Y + L+ ++f yg ++ ++L lD+
CP000780_0 1018 MSLVHERLYQSDDIARINLADYTRFLATQIFGFYGTSARQVKLTLDV 1064

CP000780_1353: domain 1 of 1, from 432 to 515: score 110.9, E = 1.4e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNN+Qv+++LL Qa ++++e+ + +++ R++S
CP000780_1 432 EIHHRVKNNMQVVIGLLHFQASTVSSPEI-----ARIVLDTETRIRS 473

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m liHE+LYks+d+ +v + Yl+ L+++L+++yg + ++ +
CP000780_1 474 MVLIHERLYKSDDFINVSLETYLRDLVNSLIHAYGTKTY---IN--V 515

CP000780_1354: domain 1 of 1, from 326 to 407: score 101.3, E = 7.3e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNN+Qv+++LL Q ++++e+ + +++ R++S
CP000780_1 326 EIHHRVKNNMQVVIGLLQFQLSAVSSPEI-----ARIVLDTETRIRS 367

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m liHE+LY s+dl ++ + +Y++ L+++L+ +y+ + l
CP000780_1 368 MVLIHERLYNSDDLINIPLEAYIRDLIDSLIYTYRSKTT-------L 407

CP000780_2398: domain 1 of 1, from 257 to 339: score 94.6, E = 6e-27
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNN+QvI SLL L a k+++e + E q+RV++
CP000780_2 257 EVHHRVKNNMQVIMSLLELNALKAENERE-----RSQYAEMQGRVMT 298

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s ++++ +Y++ L++n+ ++ + + + +
CP000780_2 299 MALIHEKLYQSPVAGSINAQDYFSDLLKNIVSASATPGVR------C 339

CP000780_1510: domain 1 of 1, from 1001 to 1084: score 93.7, E = 1.1e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNL +SLL+L + + + +++ ++ qnR +S
CP000780_1 1001 EIHHRVKNNLTSFISLLSLDGSYEETDAG-----RALRKDLQNRARS 1042

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE LY+++ ++tvd++ Yl++L+++ sy ++s +i+ +
CP000780_1 1043 MALIHETLYRTGKFSTVDMKVYLSNLLSQVAASY-KESAKIR----I 1084

CP000780_1521: domain 1 of 1, from 1031 to 1115: score 88.7, E = 2.8e-25
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++++LL++ +++d+e+ +L + +++
CP000780_1 1031 EIHHRVKNNLQIVTGLLDMTRTRAQDPET-----TGILTDMMLKIKT 1072

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA iH +LY+s ++v ++ ++ ++ +L y +s gi+ +
CP000780_1 1073 MARIHTRLYESNQSGQVSMDGQIRDMVTDLSGIYLPSSPGIR----C 1115

CP000780_1481: domain 1 of 1, from 723 to 783: score 71.0, E = 3.1e-20
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLL++ ++ de + +L + +++
CP000780_1 723 EIHHRVKNNLQLISSLLDMTRMNTHDEPA-----NSILTDMMLKIQT 764

mAliHEeLYksedldtvdf<-*
mA+iH +L +s+ ++++ +
CP000780_1 765 MAQIHARLCQSKQFGKISL 783


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-15 4 0|=
-14 12 0|=
-13 40 15|=*==
-12 142 160|============ *
-11 687 448|=====================================*====================
-10 495 579|========================================== *
-9 414 489|=================================== *
-8 291 328|========================= *
-7 127 195|=========== *
-6 148 108|========*====
-5 32 58|=== *
-4 22 31|==*
-3 5 16|=*
-2 7 8|*
-1 7 4|*
0 3 2|*
1 2 1|*
2 0 0|
3 0 0|
> 4 12 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 258.4091
P(chi-square) = 0

Total sequences searched: 2450

Whole sequence top hits:
tophits_s report:
Total hits: 11
Satisfying E cutoff: 11
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 11
Satisfying E cutoff: 11
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: