Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Xanthobacter autotrophicus Py2  

Data for CP000781  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000781.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000781_2317 CDS_2607282-2606152 112.9 7.3e-32 1
CP000781_2427 CDS_2730234-2732399 94.5 1.2e-26 1
CP000781_2008 CDS_2282499-2280709 58.6 2e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000781_2317 1/1 177 265 .. 1 94 [] 112.9 7.3e-32
CP000781_2427 1/1 533 620 .. 1 94 [] 94.5 1.2e-26
CP000781_2008 1/1 393 476 .. 1 94 [] 58.6 2e-16

Alignments of top-scoring domains:
CP000781_2317: domain 1 of 1, from 177 to 265: score 112.9, E = 7.3e-32
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+LQ+I SLL+ Qa ++d v +eaL+ ++nRV +
CP000781_2 177 EMNHRVGNSLQIIVSLLNVQASATEDGRV-----KEALNSARNRVSA 218

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++LY+s+ + tv +++Y+ L+++L s+ ++ +gi + lD
CP000781_2 219 VAQVHRRLYTSDQIATVALDQYIGSLLDDLQVSAHRDLGGITITLDA 265

CP000781_2427: domain 1 of 1, from 533 to 620: score 94.5, E = 1.2e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+LQ+++S LrLQar d + ++aL E+++R+++
CP000781_2 533 EVNHRVQNSLQLVASFLRLQARTLGDAPA-----RDALAEAERRIAA 574

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+ l+H++LY +e ++tvd+s Yl+ L ++ +s g + +L lDl
CP000781_2 575 VGLVHRQLYGGEQVETVDLSRYLTDLSHEVTNSLGAEWR-AHLMLDL 620

CP000781_2008: domain 1 of 1, from 393 to 476: score 58.6, E = 2e-16
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KN+LQv+ SLL+L + e + + + RV +
CP000781_2 393 EIHHRIKNSLQVVVSLLSLYGSGIGKSED-----RRRFDQLRLRVNT 434

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
Al+H+ LY+ d ++v ++e l +L++ + s + + +i +
CP000781_2 435 LALVHRILYEANDGSQVHLRELLGELASLIEGST-DANVRIT----V 476


Histogram of all scores:
score obs exp (one = represents 23 sequences)
----- --- ---
-15 6 0|=
-14 20 0|=
-13 75 29|=*==
-12 306 311|=============*
-11 1351 868|=====================================*=====================
-10 1052 1123|============================================== *
-9 753 948|================================= *
-8 514 636|======================= *
-7 246 377|=========== *
-6 232 210|=========*=
-5 90 113|====*
-4 48 60|==*
-3 29 31|=*
-2 9 16|*
-1 10 8|*
0 1 4|*
1 0 2|*
> 2 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 465.6817
P(chi-square) = 0

Total sequences searched: 4746

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: