hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000788.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000788_0011 CDS_7802-9331 61.8 3.1e-19 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000788_0011 1/1 309 398 .. 1 94 [] 61.8 3.1e-19
Alignments of top-scoring domains:
CP000788_0011: domain 1 of 1, from 309 to 398: score 61.8, E = 3.1e-19
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HR KN++ ++ SLL++Q+ f d ++++ + +++
CP000788_0 309 EIFHRTKNSMELVRSLLMIQSSDFPDDQN----IRKIVDNTSLKIQT 351
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+H++LY+++dl+ + +s+Yl Lte + + +++g+++ l+
CP000788_0 352 MSLVHDHLYQNKDLSEIQVSDYLLSLTEMVKAMFPNKGKGVEIQLEA 398
Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-12 4 3|==*=
-11 11 10|=========*=
-10 10 13|========== *
-9 8 11|======== *
-8 6 7|======*
-7 6 4|===*==
-6 5 2|=*===
-5 3 1|*==
-4 3 0|===
-3 1 0|=
-2 0 0|
> -1 2 -|==
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 2.8118
P(chi-square) = 0.4216
Total sequences searched: 59
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K