Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

1 accessions found for Roseiflexus castenholzii DSM 13941  

Data for CP000804  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000804.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000804_1099 CDS_1478382-1479719 91.8 9.6e-27 1
CP000804_3174 CDS_4235292-4236683 84.5 1.4e-24 1
CP000804_4114 CDS_5467725-5465677 83.3 3e-24 1
CP000804_1082 CDS_1455854-1454781 74.7 1.1e-21 2
CP000804_0278 CDS_350981-352756 69.1 4.8e-20 1
CP000804_2979 CDS_3968571-3966937 65.3 6.1e-19 1
CP000804_1534 CDS_2030983-2029934 59.6 3e-17 1
CP000804_1313 CDS_1736095-1735247 53.7 1.7e-15 1
CP000804_0714 CDS_956960-954522 32.8 2.3e-09 1
CP000804_3662 CDS_4934094-4935113 31.7 4.9e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000804_1099 1/1 235 302 .. 1 70 [] 91.8 9.6e-27
CP000804_3174 1/1 260 327 .. 1 70 [] 84.5 1.4e-24
CP000804_4114 1/1 486 553 .. 1 70 [] 83.3 3e-24
CP000804_1082 2/2 147 214 .. 1 70 [] 72.9 3.5e-21
CP000804_0278 1/1 390 457 .. 1 70 [] 69.1 4.8e-20
CP000804_2979 1/1 341 408 .. 1 70 [] 65.3 6.1e-19
CP000804_1534 1/1 142 213 .. 1 70 [] 59.6 3e-17
CP000804_1313 1/1 79 144 .. 3 70 .] 53.7 1.7e-15
CP000804_0714 1/1 573 642 .. 1 70 [] 32.8 2.3e-09
CP000804_3662 1/1 127 199 .. 1 70 [] 31.7 4.9e-09

Alignments of top-scoring domains:
CP000804_1099: domain 1 of 1, from 235 to 302: score 91.8, E = 9.6e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+AR++HD++g+ L+ +++ql++a rll ++dpe+a++ + ++
CP000804_1 235 ERVRLARDIHDGLGHYLTILNVQLQAASRLL--QRDPERAAAVIVTC 279

relarealaevRrllgdLRpaal<-*
re a++al+evRr + +++p+ l
CP000804_1 280 REVAQTALDEVRRSVAAMQPSPL 302

CP000804_3174: domain 1 of 1, from 260 to 327: score 84.5, E = 1.4e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD+++QsL+ i++ ++l + ++dp+++r +l ++
CP000804_3 260 ERARIARDIHDGIAQSLAFIRMRIDLWNEWI--ESDPQRLRSELMAL 304

relarealaevRrllgdLRpaal<-*
++++re ++e+Rr++ +LRp ++
CP000804_3 305 KTTLREQIRELRRAIFALRPVQF 327

CP000804_4114: domain 1 of 1, from 486 to 553: score 83.3, E = 3e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHDsv+Q+L +i+l++ +a+++l ++dp+++ e l+ i
CP000804_4 486 ERQRLARELHDSVSQALYGIALGARTAQTQL--ERDPARLGEPLEYI 530

relarealaevRrllgdLRpaal<-*
la+ +l+e+R+l+ +LRp l
CP000804_4 531 LSLAEAGLSEMRALIFELRPESL 553

CP000804_1082: domain 2 of 2, from 147 to 214: score 72.9, E = 3.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI+ +HD+ +Qs+s + l +e ++rll d+dpe+ar++l ++
CP000804_1 147 ERLRISLQMHDGPAQSMSNLVLRAEICQRLL--DRDPEMARAELGAL 191

relarealaevRrllgdLRpaal<-*
+ +++ +l+++Rr + dLRp++l
CP000804_1 192 KNAINATLQDTRRFIFDLRPMIL 214

CP000804_0278: domain 1 of 1, from 390 to 457: score 69.1, E = 4.8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ +AR+LHD+ +Q+L+ai++ +e ++rll ++dp+++ +ld +
CP000804_0 390 VRHQLARDLHDGPAQALAAITMNVEFIKRLL--ERDPARVLPELDKL 434

relarealaevRrllgdLRpaal<-*
+la+++ +vR +l +LRp al
CP000804_0 435 GQLAKRTTHDVRTMLFELRPLAL 457

CP000804_2979: domain 1 of 1, from 341 to 408: score 65.3, E = 6.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
Ra IAR+LHD+ Qs++ai++ +e +++ll ++ pe+++ +l+ +
CP000804_2 341 VRAAIARDLHDGPTQSIAAIAMNIEFIKKLL--RAMPERVEGELEVL 385

relarealaevRrllgdLRpaal<-*
+el++++ ++R ll +LRp +l
CP000804_2 386 AELVQKTAYDIRTLLFELRPLGL 408

CP000804_1534: domain 1 of 1, from 142 to 213: score 59.6, E = 3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrllds..dkdpeeareald
ER R+ARE HD+ +Q L+ + le++ l+++++ +++e+++ +
CP000804_1 142 ERMRLAREVHDGPAQVLANSLMLLETCYSLAQQqtGEHAEKLAVMIG 188

eirelarealaevRrllgdLRpaal<-*
++r++ re+l+evRr + +LRp++
CP000804_1 189 RLRDATREGLSEVRRFIANLRPGQV 213

CP000804_1313: domain 1 of 1, from 79 to 144: score 53.7, E = 1.7e-15
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeire
+RIARELHD+v+Q+++a+ l+l++++ ++ + ++ar++l+++ e
CP000804_1 79 RRIARELHDGVAQQITAACLHLQALAGRY--RPRSPKARATLERAIE 123

larealaevRrllgdLRpaal<-*
l r a +evRr++ d paal
CP000804_1 124 LTRSAADEVRRVIADAPPAAL 144

CP000804_0714: domain 1 of 1, from 573 to 642: score 32.8, E = 2.3e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIA+E+HD+v L a+ +l +++ + ++ ++ + + +
CP000804_0 573 ERERIAQEIHDGVLPVLGALPFGLTQIEQSV--QTGAPadTIISICE 617

eirelarealaevRrllgdLRpaal<-*
+ re a ++ +e+R +l++L+p++
CP000804_0 618 AYRERAVRTTRELRSILRHLQPPIV 642

CP000804_3662: domain 1 of 1, from 127 to 199: score 31.7, E = 4.9e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.....eare
E +RI ++HD+ Q L+a++ +l l++++l d++ +++ +++++
CP000804_3 127 ELQRIILDIHDGPVQKLFAVSSHLALVQARL--DEHSDtdlrrQIAP 171

aldeirelarealaevRrllgdLRpaal<-*
+++i +l + al+e+R++l+++R a++
CP000804_3 172 LIERINGLMESALQEIRATLSGFRLAEF 199


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 3 0|=
-13 20 0|==
-12 45 48|====*
-11 102 396|========== *
-10 332 920|=============================== *
-9 632 1045|==========================================================*
-8 587 805|====================================================== *
-7 595 506|=============================================*=========
-6 561 286|=========================*=========================
-5 541 153|=============*====================================
-4 323 80|=======*======================
-3 201 41|===*===============
-2 141 21|=*===========
-1 82 10|*=======
0 54 5|*====
1 25 2|*==
2 26 1|*==
3 16 0|==
4 12 0|==
5 5 0|=
6 7 0|=
7 2 0|=
8 2 0|=
9 0 0|
10 2 0|=
11 2 0|=
12 1 0|=
> 13 11 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 5008.3047
P(chi-square) = 0

Total sequences searched: 4330

Whole sequence top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: