hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000806.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000806_1876 CDS_1908880-1905542 156.3 3.4e-44 2
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000806_1876 2/2 916 1004 .. 1 94 [] 156.3 3.4e-44
Alignments of top-scoring domains:
CP000806_1876: domain 2 of 2, from 916 to 1004: score 156.3, E = 3.4e-44
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvI SLL+LQar+++d + +e+LrEsqnRV++
CP000806_1 916 EIHHRVKNNLQVICSLLNLQARSVEDTQI-----KELLRESQNRVRA 957
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+HE+LY+se++ ++++++Yl+ L++n+ ++y +i+Lk D+
CP000806_1 958 MSLVHEKLYRSENIASINLADYLQDLAKNIANAYKNVTTKINLKTDI 1004
Histogram of all scores:
score obs exp (one = represents 20 sequences)
----- --- ---
-15 24 0|==
-14 49 0|===
-13 102 29|=*====
-12 298 312|===============*
-11 1155 870|===========================================*==============
-10 879 1127|============================================ *
-9 832 951|========================================== *
-8 539 638|=========================== *
-7 304 379|================ *
-6 321 211|==========*======
-5 107 113|=====*
-4 69 60|==*=
-3 42 31|=*=
-2 14 16|*
-1 15 8|*
0 7 4|*
1 2 2|*
2 0 1|*
3 0 0|
4 1 0|=
5 0 0|
6 0 0|
> 7 2 -|=
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 435.5575
P(chi-square) = 0
Total sequences searched: 4762
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K