Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Frankia sp. EAN1pec  

Data for CP000820  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000820.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000820_3215 CDS_3887034-3885817 85.6 1.1e-24 1
CP000820_2235 CDS_2711903-2710563 85.1 1.5e-24 1
CP000820_7010 CDS_8741587-8742807 83.4 4.9e-24 1
CP000820_6560 CDS_8130550-8131746 82.9 6.8e-24 1
CP000820_3654 CDS_4413683-4412349 77.7 2.3e-22 1
CP000820_3324 CDS_4018055-4016718 77.5 2.6e-22 1
CP000820_1622 CDS_1974942-1973530 77.1 3.4e-22 1
CP000820_0523 CDS_619891-621204 75.3 1.1e-21 1
CP000820_6960 CDS_8671467-8669977 74.9 1.6e-21 1
CP000820_6221 CDS_7712875-7711547 74.6 1.8e-21 1
CP000820_5287 CDS_6518538-6517219 74.0 2.8e-21 2
CP000820_4583 CDS_5597121-5595718 73.8 3.2e-21 1
CP000820_3123 CDS_3750947-3752143 72.1 1e-20 1
CP000820_3768 CDS_4568087-4569265 71.5 1.6e-20 1
CP000820_2264 CDS_2748096-2749394 67.9 1.8e-19 1
CP000820_4160 CDS_5055716-5053929 67.5 2.4e-19 1
CP000820_1407 CDS_1728877-1731072 64.9 1.3e-18 1
CP000820_3757 CDS_4554835-4556964 64.1 2.3e-18 1
CP000820_6296 CDS_7810153-7808912 63.4 3.7e-18 1
CP000820_6378 CDS_7918600-7920141 62.8 5.7e-18 1
CP000820_4875 CDS_5976953-5975058 58.7 9.2e-17 1
CP000820_4124 CDS_5013994-5011607 58.3 1.2e-16 1
CP000820_0383 CDS_462141-463397 56.1 5.5e-16 1
CP000820_6969 CDS_8686609-8687775 54.7 1.4e-15 1
CP000820_6359 CDS_7890564-7892294 53.9 2.4e-15 2
CP000820_4248 CDS_5177439-5176408 53.7 2.7e-15 1
CP000820_7074 CDS_8820081-8821865 52.4 6.8e-15 1
CP000820_4554 CDS_5555609-5554002 48.0 1.3e-13 1
CP000820_0500 CDS_591407-589386 47.9 1.4e-13 1
CP000820_6564 CDS_8136138-8138003 46.0 5.1e-13 1
CP000820_0518 CDS_614022-614954 45.4 7.6e-13 1
CP000820_1937 CDS_2365089-2366795 41.1 1.4e-11 1
CP000820_6802 CDS_8451033-8452775 37.6 1.5e-10 1
CP000820_6679 CDS_8303353-8303832 34.9 9.6e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000820_3215 1/1 192 259 .. 1 70 [] 85.6 1.1e-24
CP000820_2235 1/1 234 301 .. 1 70 [] 85.1 1.5e-24
CP000820_7010 1/1 196 263 .. 1 70 [] 83.4 4.9e-24
CP000820_6560 1/1 63 130 .. 1 70 [] 82.9 6.8e-24
CP000820_3654 1/1 190 257 .. 1 70 [] 77.7 2.3e-22
CP000820_3324 1/1 190 257 .. 1 70 [] 77.5 2.6e-22
CP000820_1622 1/1 261 329 .. 1 70 [] 77.1 3.4e-22
CP000820_0523 1/1 224 291 .. 1 70 [] 75.3 1.1e-21
CP000820_6960 1/1 233 300 .. 1 70 [] 74.9 1.6e-21
CP000820_6221 1/1 217 285 .. 1 70 [] 74.6 1.8e-21
CP000820_4583 1/1 193 260 .. 1 70 [] 73.8 3.2e-21
CP000820_3123 1/1 184 252 .. 1 70 [] 72.1 1e-20
CP000820_3768 1/1 189 256 .. 1 70 [] 71.5 1.6e-20
CP000820_5287 1/2 185 253 .. 1 70 [] 71.1 2.1e-20
CP000820_2264 1/1 240 307 .. 1 70 [] 67.9 1.8e-19
CP000820_4160 1/1 401 468 .. 1 70 [] 67.5 2.4e-19
CP000820_1407 1/1 481 548 .. 1 70 [] 64.9 1.3e-18
CP000820_3757 1/1 496 563 .. 1 70 [] 64.1 2.3e-18
CP000820_6296 1/1 187 254 .. 1 70 [] 63.4 3.7e-18
CP000820_6378 1/1 222 289 .. 1 70 [] 62.8 5.7e-18
CP000820_4875 1/1 408 472 .. 1 70 [] 58.7 9.2e-17
CP000820_4124 1/1 729 793 .. 1 70 [] 58.3 1.2e-16
CP000820_0383 1/1 221 288 .. 1 70 [] 56.1 5.5e-16
CP000820_6969 1/1 177 251 .. 1 70 [] 54.7 1.4e-15
CP000820_4248 1/1 147 214 .. 1 70 [] 53.7 2.7e-15
CP000820_6359 2/2 355 450 .. 1 70 [] 53.5 3.1e-15
CP000820_7074 1/1 401 466 .. 1 70 [] 52.4 6.8e-15
CP000820_4554 1/1 473 535 .] 1 68 [. 48.0 1.3e-13
CP000820_0500 1/1 607 671 .. 1 70 [] 47.9 1.4e-13
CP000820_6564 1/1 427 496 .. 1 70 [] 46.0 5.1e-13
CP000820_0518 1/1 109 155 .. 1 54 [. 45.4 7.6e-13
CP000820_1937 1/1 374 439 .. 1 70 [] 41.1 1.4e-11
CP000820_6802 1/1 388 452 .. 1 70 [] 37.6 1.5e-10
CP000820_6679 1/1 1 49 [. 20 70 .] 34.9 9.6e-10

Alignments of top-scoring domains:
CP000820_3215: domain 1 of 1, from 192 to 259: score 85.6, E = 1.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+++++++++k+q+++a +ll ++p a+eal i
CP000820_3 192 ERLRIARELHDVIAHHITLVKVQASVASHLL--CEEPSGAEEALGHI 236

relarealaevRrllgdLRpaal<-*
r+++r+ l+e+R l+++LR++++
CP000820_3 237 RHASRTVLEELRSLVTVLRDTGE 259

CP000820_2235: domain 1 of 1, from 234 to 301: score 85.1, E = 1.5e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++g++Ls++++++++++ + ++pe+++ a+ i
CP000820_2 234 ERTRIAREMHDVLGHRLSLLTMHAGALEFHP--GAPPEQIAGAAGVI 278

relarealaevRrllgdLRpaal<-*
re a+eal+++R+++g+LR++ +
CP000820_2 279 RESAHEALRDLRAAIGVLREGPE 301

CP000820_7010: domain 1 of 1, from 196 to 263: score 83.4, E = 4.9e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v+++ s++++q+++ar+++ ++d ++a +a++++
CP000820_7 196 ERTRIARELHDVVAHRVSLMTVQASGARAVA--AEDLAAALRAMEAV 240

relarealaevRrllgdLRpaal<-*
+e++r+al+e+R+llg+LRp +
CP000820_7 241 EEAGRQALEELRHLLGVLRPETS 263

CP000820_6560: domain 1 of 1, from 63 to 130: score 82.9, E = 6.8e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HD vg+sL++i+ +++ ++++ d +pe+ +eal i
CP000820_6 63 ERARMAREMHDIVGHSLAVIIALADGGAYAV--DVAPERGKEALNLI 107

relarealaevRrllgdLRpaal<-*
+++r++l e+Rr+lg+LR+ a+
CP000820_6 108 GDTSRRSLGELRRILGVLRERAE 130

CP000820_3654: domain 1 of 1, from 190 to 257: score 77.7, E = 2.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v+++++++ q+++a++l+ +++p++ + l+++
CP000820_3 190 ERTRIARELHDVVAHHITLAHAQAGTAAHLV--RTHPDQTEPILTNL 234

relarealaevRrllgdLRpaal<-*
++ + al+++ +++g LR++++
CP000820_3 235 TATTSSALRDLKATVGLLRHGDD 257

CP000820_3324: domain 1 of 1, from 190 to 257: score 77.5, E = 2.6e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v+++++++ q+++a++l+ +++p++ + l+++
CP000820_3 190 ERTRIARELHDVVAHHITLAHAQAGTAAHLV--RTHPDQTEPILTNL 234

relarealaevRrllgdLRpaal<-*
++ + al+++ +++g LR +++
CP000820_3 235 TATTSSALRDLKATVGLLRQSDD 257

CP000820_1622: domain 1 of 1, from 261 to 329: score 77.1, E = 3.4e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v ++ s++ +q+++ar++l d++p+ area++++
CP000820_1 261 ERARIARELHDVVTHNVSVMVIQAGAARKVL--DANPDLAREAIRAV 305

relarealaevRrllgdLR.paal<-*
++ +r a++e+R++ g L ++
CP000820_1 306 ETSGRSAMTELRHVMGLLTmSGGA 329

CP000820_0523: domain 1 of 1, from 224 to 291: score 75.3, E = 1.1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A ELHD +g++ ++ lq+++arrl+ +++p+ a++al+ i
CP000820_0 224 ERGRLAGELHDALGHTVNVMVLQAGVARRLF--AENPAFAQQALADI 268

relarealaevRrllgdLRpaal<-*
+ +real e+ r+l++L+p ++
CP000820_0 269 ENVGREALGELDRMLRVLHPVQD 291

CP000820_6960: domain 1 of 1, from 233 to 300: score 74.9, E = 1.6e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v+++++++k q+ +a +ll + p++a+eal+ i
CP000820_6 233 ERTRIARELHDVVAHHITLVKSQAAVASHLL--YEQPAKADEALAHI 277

relarealaevRrllgdLRpaal<-*
r +r+ l+e+ l+++LR++ +
CP000820_6 278 RLSSRTVLNELGSLVSVLRDTPE 300

CP000820_6221: domain 1 of 1, from 217 to 285: score 74.6, E = 1.8e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A ELHDs+g++L++ +lq+++ar l+ ++dp+ + +al+ i
CP000820_6 217 ERNRLAAELHDSIGHALTLTILQAGAARELA--ATDPAFVHRALTVI 261

relarealaevRrllgdLR.paal<-*
+e++r+a++++ r+lg LR+ +
CP000820_6 262 EETGRRAMDDLERTLGLLRdAPMG 285

CP000820_4583: domain 1 of 1, from 193 to 260: score 73.8, E = 3.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++++++k+q+ +a ++l + p+ a+eal i
CP000820_4 193 ERLRIARELHDVVAHHITLVKVQAAVASHML--YEQPAGADEALGHI 237

relarealaevRrllgdLRpaal<-*
r+++ + l+e+ l+ +LR++ +
CP000820_4 238 RRASATVLDELKLLVYALRDTSE 260

CP000820_3123: domain 1 of 1, from 184 to 252: score 72.1, E = 1e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRI+RE+HD v+++L+++ +++a rl+ ++d e+a a++++
CP000820_3 184 ERARISREMHDIVAHHLTVMVAVSDAATRLV--RADVEQAIGAMRTV 228

relarealaevRrllgdLR.paal<-*
+++r+al+++Rrllg+L++++ +
CP000820_3 229 SATGRDALRDTRRLLGVLQdDQPE 252

CP000820_3768: domain 1 of 1, from 189 to 256: score 71.5, E = 1.6e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR+LHD+v+++ sai++ +++ + + ++ p++a+eal+ i
CP000820_3 189 ERERLARDLHDTVAHHVSAIAIRAQAGIATA--PSSPAAAAEALRVI 233

relarealaevRrllgdLRpaal<-*
+ a+++lae+R+++++LR ++
CP000820_3 234 ELEASRTLAEMRAMVRVLRRDEP 256

CP000820_5287: domain 1 of 2, from 185 to 253: score 71.1, E = 2.1e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHD v++s +++ l++ +ar +l + p++a+++l+++
CP000820_5 185 ERASIARELHDIVAHSVTVMLLGVRGARDVL--RVSPDRADDTLARV 229

relarealaevRrllgdLR.paal<-*
++ ++++l e+Rr+l++LR p++
CP000820_5 230 ETNGEQSLVELRRILTVLRaPDTP 253

CP000820_2264: domain 1 of 1, from 240 to 307: score 67.9, E = 1.8e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+++ l++a++++ ++dp+ a ++e+
CP000820_2 240 ERRRIERDLHDGAQQRLVAVAMTLGRAQARF--ADDPDGAHGLIAEA 284

relarealaevRrllgdLRpaal<-*
++ ++al e+R+l+++++p++l
CP000820_2 285 HAETKRALVELRDLARGIHPSVL 307

CP000820_4160: domain 1 of 1, from 401 to 468: score 67.5, E = 2.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD+v Q+L a+++ +++a+ + d+dp+ + ++ i
CP000820_4 401 ERNRIARDLHDGVQQRLLALAMSASAAEWST--DDDPDSTASVFRDI 445

relarealaevRrllgdLRpaal<-*
r+ + a aevR+++++L p +l
CP000820_4 446 RAGLLAANAEVRNVARGLDPEIL 468

CP000820_1407: domain 1 of 1, from 481 to 548: score 64.9, E = 1.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ +LHD++g +L+a++ ++++a l+ d+d ++ar ld +
CP000820_1 481 ERRRLRHDLHDGLGPTLTAAATKVDAAGNLV--DRDVARARNLLDSV 525

relarealaevRrllgdLRpaal<-*
r+ + ala++Rrl+ +LRp++l
CP000820_1 526 RRDLTSALADLRRLVYALRPPVL 548

CP000820_3757: domain 1 of 1, from 496 to 563: score 64.1, E = 2.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD++g +L+a l l++ar +l ++ pe +e l+ +
CP000820_3 496 ERRRLQRDLHDGLGPRLTATGLTLDAARNRL--RSTPELSDELLADA 540

relarealaevRrllgdLRpaal<-*
r+ ++ea+++vRrl+ +L ++ l
CP000820_3 541 RAQVNEAIDDVRRLVYALGDPSL 563

CP000820_6296: domain 1 of 1, from 187 to 254: score 63.4, E = 3.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA++ HD v++sL+++ l + +arr + ++dp+ a+eal+++
CP000820_6 187 ERRRIAQDVHDLVAHSLAVALLNITGARRTM--RRDPALADEALARA 231

relarealaevRrllgdLRpaal<-*
++ +r++la +Rr++g L ++
CP000820_6 232 EQVGRDSLAGIRRAVGLLGGGDT 254

CP000820_6378: domain 1 of 1, from 222 to 289: score 62.8, E = 5.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARE HD+vg++Ls i+lq+ +a+++l d+ pe+a+ al++i
CP000820_6 222 ERLRMAREVHDVVGHGLSIISLQAAVALHVL--DRRPEQAQIALEAI 266

relarealaevRrllgdLRpaal<-*
r+++ +al+e+R++l R +
CP000820_6 267 RRTSVDALDELRATLALTRARDA 289

CP000820_4875: domain 1 of 1, from 408 to 472: score 58.7, E = 9.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v Q+L+a lq+++++r++ +e a+ +l +
CP000820_4 408 ERDRIARDLHDVVIQRLFATGLQMQGLARVI-----DEGAAVRLNDA 449

relarealaevRrllgdLRpaal<-*
+ +++++a++R+++ L +a
CP000820_4 450 VRELDQTIADIRHTIFSLTASAG 472

CP000820_4124: domain 1 of 1, from 729 to 793: score 58.3, E = 1.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+RIAR+LHD v Q+L+ai l+l+ + r++ d +++l ++
CP000820_4 729 DRERIARDLHDLVIQRLFAIGLHLQSLTRAV---GD--VTAARLNAA 770

relarealaevRrllgdLRpaal<-*
+ ++ +++++Rr++ L+p+
CP000820_4 771 ITGLDSTIDDIRRTIFKLQPTPV 793

CP000820_0383: domain 1 of 1, from 221 to 288: score 56.1, E = 5.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+RI R+LHD+ +L a++++l+lar l ++dp+ a++ ++e+
CP000820_0 221 DLRRIERDLHDGAQARLVALAMGLGLAREKL--ADDPDTAAKMVEEA 265

relarealaevRrllgdLRpaal<-*
++ ++ al+e+R+l+++++pa+l
CP000820_0 266 HGEVKLALRELRDLARGIHPAIL 288

CP000820_6969: domain 1 of 1, from 177 to 251: score 54.7, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.......ea
ER IA ELHD+++++L+++++q+++a++l+ d p +++ + +e+
CP000820_6 177 ERVLIAAELHDVLAHGLAVANVQASVAAHLI--DQLPRrgdaslqEL 221

realdeirelarealaevRrllgdLRpaal<-*
++l+++ +++r +l e+R++l +L+ ++
CP000820_6 222 SRTLHNLSDTSRATLHELRAVLDVLHGGEA 251

CP000820_4248: domain 1 of 1, from 147 to 214: score 53.7, E = 2.7e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ ++ ++++ l++a++ll ++dp++a++ l +
CP000820_4 147 ELKRIERDLHDGAQARIVSLAMNLGMAEALL--HSDPAAAAKLLSDA 191

relarealaevRrllgdLRpaal<-*
r a al+++R++ + ++p++l
CP000820_4 192 RLSAVGALDDLRAVMHSIHPSVL 214

CP000820_6359: domain 2 of 2, from 355 to 450: score 53.5, E = 3.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ER+RI R+LHD+ Q+L +++++l l+r l+ d d ++++++++++
CP000820_6 355 ERRRIERDLHDGAQQQLVSLAVGLRLVRDLIS-DGDSDgsssngsss 400

..................earealdeirelarealaevRrllgdLRpaal
++++++ ++ ++++++ +a+e l++++e + e+++evR+l++++ p+ l
CP000820_6 401 ndgdgsvpgaperdedlaAADELLTAMAEQVTETITEVRNLAHGIYPPLL 450

<-*

CP000820_6 - -

CP000820_7074: domain 1 of 1, from 401 to 466: score 52.4, E = 6.8e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a++ l+lar + ++ + +al+ +
CP000820_7 401 ERRRIERDLHDGAQQRLLALSARLGLAREQS--TDQ--ATVAALEGA 443

relarealaevRrllgdLRpaal<-*
re +r alae+R l+++++p++l
CP000820_7 444 REDLRAALAELRGLARGIHPPVL 466

CP000820_4554: domain 1 of 1, from 473 to 535: score 48.0, E = 1.3e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+ai l+l+ ++ +++ +++ ++l+++
CP000820_4 473 DRDRIARDLHDLVLQRLFAIGLHLQSLA-----RAAGDMIGARLTAA 514

relarealaevRrllgdLRpa<-*
++++++++e+Rr++ + +p+
CP000820_4 515 IDALDQTIEEIRRTILQVQPS 535

CP000820_0500: domain 1 of 1, from 607 to 671: score 47.9, E = 1.4e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+ai l+l+ + r++ d a+++l+ +
CP000820_0 607 DRDRIARDLHDQVIQRLFAIGLHLQSLTRAV---GD--IAAARLTSA 648

relarealaevRrllgdLRpaal<-*
+++++++++R+++ dL+p +
CP000820_0 649 INALDHTIDDIRHTIFDLHPIQP 671

CP000820_6564: domain 1 of 1, from 427 to 496: score 46.0, E = 5.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
R+RI R+LHD+ Q+L ++l l lar +l +p+++e+ + l+
CP000820_6 427 QRRRIERDLHDGAQQQLVTAALILRLARDRL--GPAPPdpELGTLLR 471

eirelarealaevRrllgdLRpaal<-*
++++ ++ a +e+R+l+++++pa+l
CP000820_6 472 RAADGLEAAVKELRELARGIHPAVL 496

CP000820_0518: domain 1 of 1, from 109 to 155: score 45.4, E = 7.6e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD++g +Ls++++q+ela+rl+ + ++l+ +
CP000820_0 109 ERLRFARDLHDVLGYNLSLMAVQSELAARLA-------DLGAELAGA 148

relarea<-*
+ l+r a
CP000820_0 149 QSLLRSA 155

CP000820_1937: domain 1 of 1, from 374 to 439: score 41.1, E = 1.4e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L a++l+l++ ++ +++ ++ + +l++
CP000820_1 374 DRDRIARDLHDHVMQRLYAVALGLQGMAA----AEERPQSAGRLTTY 416

relarealaevRrllgdLRpaal<-*
+ ++ +++e+R ++ +LR
CP000820_1 417 VDDLDATIREIRSTVFELRGRRS 439

CP000820_6802: domain 1 of 1, from 388 to 452: score 37.6, E = 1.5e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+++a++l+++ ++ + +++ + +l
CP000820_6 388 DRGRIARDLHDHVIQRMFAVALGMQDLA-----QYENPSNAGRLNGY 429

relarealaevRrllgdLRpaal<-*
e ++ +++++Rr + +LR +
CP000820_6 430 VEDIDATIKDIRRSIFELRGQSP 452

CP000820_6679: domain 1 of 1, from 1 to 49: score 34.9, E = 9.6e-10
*->iklqlelarrlldsdkdpeearealdeirelarealaevRrllgdLR
+++q+ela+rl+ + +++a+e++ e+r+ a+++l+e+R+++ ++R
CP000820_6 1 MAVQSELAARLV--EHGDAAAAERMLEVRQVAHDSLREMRAVVDGYR 45

paal<-*
a+l
CP000820_6 46 RADL 49


Histogram of all scores:
score obs exp (one = represents 20 sequences)
----- --- ---
-14 3 0|=
-13 28 1|*=
-12 99 80|===*=
-11 173 659|========= *
-10 565 1529|============================= *
-9 1013 1736|=================================================== *
-8 974 1338|================================================= *
-7 1132 841|==========================================*==============
-6 939 476|=======================*=======================
-5 885 255|============*================================
-4 500 133|======*==================
-3 302 68|===*============
-2 198 35|=*========
-1 128 17|*======
0 79 9|*===
1 48 4|*==
2 34 2|*=
3 22 1|*=
4 8 0|=
5 5 0|=
6 2 0|=
7 6 0|=
8 2 0|=
9 1 0|=
10 1 0|=
11 1 0|=
12 2 0|=
13 0 0|
14 1 0|=
15 1 0|=
16 0 0|
17 1 0|=
18 0 0|
19 0 0|
> 20 38 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 7253.5405
P(chi-square) = 0

Total sequences searched: 7191

Whole sequence top hits:
tophits_s report:
Total hits: 34
Satisfying E cutoff: 34
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 34
Satisfying E cutoff: 34
Total memory: 33K


Acknowledgements:

This research is funded by:

Developed by: